BLASTX nr result
ID: Ophiopogon26_contig00052870
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00052870 (516 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC13967.1| 50S ribosomal protein L33, partial [Rhizophagus i... 98 7e-24 gb|PKY44688.1| 50S ribosomal protein L33 [Rhizophagus irregularis] 98 7e-24 gb|PKK75220.1| hypothetical protein RhiirC2_655648, partial [Rhi... 73 4e-14 gb|ORY00694.1| mitochondrial ribosomal protein subunit L39 [Basi... 73 4e-14 gb|KZP11909.1| hypothetical protein FIBSPDRAFT_799734 [Fibularhi... 70 5e-13 gb|OJA15438.1| hypothetical protein AZE42_02196, partial [Rhizop... 67 2e-11 ref|XP_003028980.1| mitochondrial 54S ribosomal protein YmL39 [S... 66 2e-11 ref|XP_021884752.1| 50S ribosomal protein L33 [Lobosporangium tr... 66 2e-11 gb|KZT24314.1| hypothetical protein NEOLEDRAFT_1179310 [Neolenti... 65 4e-11 gb|KDR70952.1| hypothetical protein GALMADRAFT_75791, partial [G... 65 5e-11 gb|KIM38436.1| hypothetical protein M413DRAFT_30256 [Hebeloma cy... 65 6e-11 ref|XP_018225133.1| ribosomal protein L33 [Pneumocystis carinii ... 64 8e-11 gb|KIJ54283.1| hypothetical protein M422DRAFT_221818 [Sphaerobol... 64 8e-11 gb|PPQ91187.1| hypothetical protein CVT25_001203 [Psilocybe cyan... 64 8e-11 gb|KXN92992.1| 54S ribosomal protein L39, mitochondrial, partial... 64 1e-10 ref|XP_002174025.1| mitochondrial 54S ribosomal protein YmL39 [S... 64 1e-10 ref|NP_596108.1| mitochondrial ribosomal protein subunit L39 (pr... 64 1e-10 gb|KJA13218.1| hypothetical protein HYPSUDRAFT_73122 [Hypholoma ... 64 1e-10 ref|XP_021868318.1| hypothetical protein BD324DRAFT_584122, part... 64 1e-10 gb|OAX41279.1| hypothetical protein K503DRAFT_735927, partial [R... 64 2e-10 >gb|PKC13967.1| 50S ribosomal protein L33, partial [Rhizophagus irregularis] Length = 56 Score = 97.8 bits (242), Expect = 7e-24 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = +2 Query: 140 RTTIVRLVSTAGTGYFFTKIRPRQLPKLSFVKYDPKVGRRVLFTEQKNR 286 RTTIVRLVS+AGTGYFFTKIRPRQLPKLSFVK+DPKVGRRVLFTEQKNR Sbjct: 8 RTTIVRLVSSAGTGYFFTKIRPRQLPKLSFVKFDPKVGRRVLFTEQKNR 56 >gb|PKY44688.1| 50S ribosomal protein L33 [Rhizophagus irregularis] Length = 56 Score = 97.8 bits (242), Expect = 7e-24 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = +2 Query: 140 RTTIVRLVSTAGTGYFFTKIRPRQLPKLSFVKYDPKVGRRVLFTEQKNR 286 RTTIVRLVS+AGTGYFFTKIRPRQLPKLSFVK+DPKVGRRVLFTEQKNR Sbjct: 8 RTTIVRLVSSAGTGYFFTKIRPRQLPKLSFVKFDPKVGRRVLFTEQKNR 56 >gb|PKK75220.1| hypothetical protein RhiirC2_655648, partial [Rhizophagus irregularis] gb|PKY26261.1| hypothetical protein RhiirB3_337353, partial [Rhizophagus irregularis] Length = 51 Score = 72.8 bits (177), Expect = 4e-14 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +2 Query: 140 RTTIVRLVSTAGTGYFFTKIRPRQLPKLSFVKYDPK 247 RTTIVRLVS+AGTGYFFTKIRPRQLPKLSFVK+DPK Sbjct: 1 RTTIVRLVSSAGTGYFFTKIRPRQLPKLSFVKFDPK 36 >gb|ORY00694.1| mitochondrial ribosomal protein subunit L39 [Basidiobolus meristosporus CBS 931.73] Length = 56 Score = 72.8 bits (177), Expect = 4e-14 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +2 Query: 140 RTTIVRLVSTAGTGYFFTKIRPRQLPKLSFVKYDPKVGRRVLFTEQKNR 286 RT IV+LVS+AGTG+F+T+ RPR PKLSF KYDPKV + VLFTEQK R Sbjct: 7 RTVIVKLVSSAGTGFFYTRTRPRANPKLSFRKYDPKVRQHVLFTEQKVR 55 >gb|KZP11909.1| hypothetical protein FIBSPDRAFT_799734 [Fibularhizoctonia sp. CBS 109695] Length = 59 Score = 70.1 bits (170), Expect = 5e-13 Identities = 34/47 (72%), Positives = 38/47 (80%) Frame = +2 Query: 140 RTTIVRLVSTAGTGYFFTKIRPRQLPKLSFVKYDPKVGRRVLFTEQK 280 RT IVRL+STA +GYF+T RPR PKLSFVKYDPKV +RVLF E K Sbjct: 9 RTVIVRLISTAQSGYFYTTARPRLGPKLSFVKYDPKVKQRVLFVESK 55 >gb|OJA15438.1| hypothetical protein AZE42_02196, partial [Rhizopogon vesiculosus] Length = 92 Score = 67.0 bits (162), Expect = 2e-11 Identities = 38/80 (47%), Positives = 50/80 (62%) Frame = +2 Query: 41 FCIKWQRRLKQGNK*QYITE*SKNEILSNHYYFRTTIVRLVSTAGTGYFFTKIRPRQLPK 220 F ++ R L+Q + Q+ + E ++ RT IVRL+STA TG+F+T RPRQ K Sbjct: 13 FILQLSRSLRQTTRAQW----QRGEEMAGKAKARTIIVRLISTAQTGFFYTTQRPRQGAK 68 Query: 221 LSFVKYDPKVGRRVLFTEQK 280 L+ VKYDPKV RVLF E K Sbjct: 69 LAAVKYDPKVKARVLFVESK 88 >ref|XP_003028980.1| mitochondrial 54S ribosomal protein YmL39 [Schizophyllum commune H4-8] gb|EFI94077.1| hypothetical protein SCHCODRAFT_31863, partial [Schizophyllum commune H4-8] Length = 51 Score = 65.9 bits (159), Expect = 2e-11 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = +2 Query: 140 RTTIVRLVSTAGTGYFFTKIRPRQLPKLSFVKYDPKVGRRVLFTEQK 280 RT IVRL+STA TG+F+TK+RPR P+LS VKYDP V RVLF E K Sbjct: 1 RTLIVRLISTAQTGFFYTKVRPRLGPRLSAVKYDPVVKSRVLFVESK 47 >ref|XP_021884752.1| 50S ribosomal protein L33 [Lobosporangium transversale] gb|ORZ27005.1| 50S ribosomal protein L33 [Lobosporangium transversale] Length = 59 Score = 65.9 bits (159), Expect = 2e-11 Identities = 30/47 (63%), Positives = 38/47 (80%) Frame = +2 Query: 140 RTTIVRLVSTAGTGYFFTKIRPRQLPKLSFVKYDPKVGRRVLFTEQK 280 RT IV+L+STAGTG+F+T RPR PKLSF+K+DP+V + VLF E K Sbjct: 8 RTIIVKLLSTAGTGFFYTTRRPRTTPKLSFMKFDPRVNQTVLFNEAK 54 >gb|KZT24314.1| hypothetical protein NEOLEDRAFT_1179310 [Neolentinus lepideus HHB14362 ss-1] Length = 58 Score = 65.1 bits (157), Expect = 4e-11 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +2 Query: 140 RTTIVRLVSTAGTGYFFTKIRPRQLPKLSFVKYDPKVGRRVLFTEQK 280 RT IVRLVSTA TG+F+T R RQ PKLS VKYDPKV +RVLF E K Sbjct: 8 RTMIVRLVSTAQTGFFYTTQRLRQGPKLSAVKYDPKVKQRVLFVESK 54 >gb|KDR70952.1| hypothetical protein GALMADRAFT_75791, partial [Galerina marginata CBS 339.88] Length = 51 Score = 64.7 bits (156), Expect = 5e-11 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = +2 Query: 140 RTTIVRLVSTAGTGYFFTKIRPRQLPKLSFVKYDPKVGRRVLFTEQK 280 RT IVRL+STA TG+F+T R RQ PKLS VKYDPKV +RVLF E K Sbjct: 1 RTIIVRLISTAQTGFFYTTQRLRQGPKLSAVKYDPKVKQRVLFVENK 47 >gb|KIM38436.1| hypothetical protein M413DRAFT_30256 [Hebeloma cylindrosporum h7] Length = 59 Score = 64.7 bits (156), Expect = 6e-11 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = +2 Query: 140 RTTIVRLVSTAGTGYFFTKIRPRQLPKLSFVKYDPKVGRRVLFTEQK 280 RT IVRL+STA TG+F+T R RQ PKLS VKYDPKV +RVLF E K Sbjct: 8 RTIIVRLISTAQTGFFYTTQRLRQGPKLSAVKYDPKVKQRVLFVESK 54 >ref|XP_018225133.1| ribosomal protein L33 [Pneumocystis carinii B80] gb|KTW26942.1| ribosomal protein L33 [Pneumocystis carinii B80] Length = 56 Score = 64.3 bits (155), Expect = 8e-11 Identities = 29/47 (61%), Positives = 38/47 (80%) Frame = +2 Query: 140 RTTIVRLVSTAGTGYFFTKIRPRQLPKLSFVKYDPKVGRRVLFTEQK 280 RT +V+L+STAGTG+F+T RPR PKLS +K+DP+V +RVLF E K Sbjct: 8 RTILVKLLSTAGTGWFYTASRPRLSPKLSCIKFDPRVNKRVLFEEAK 54 >gb|KIJ54283.1| hypothetical protein M422DRAFT_221818 [Sphaerobolus stellatus SS14] Length = 57 Score = 64.3 bits (155), Expect = 8e-11 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = +2 Query: 140 RTTIVRLVSTAGTGYFFTKIRPRQLPKLSFVKYDPKVGRRVLFTEQK 280 RT IVRL+STA TG+F+TK RPR PKL+ +KYDP V RVLF E K Sbjct: 7 RTLIVRLISTAQTGFFYTKTRPRLSPKLTAIKYDPVVKARVLFIESK 53 >gb|PPQ91187.1| hypothetical protein CVT25_001203 [Psilocybe cyanescens] Length = 58 Score = 64.3 bits (155), Expect = 8e-11 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = +2 Query: 140 RTTIVRLVSTAGTGYFFTKIRPRQLPKLSFVKYDPKVGRRVLFTEQK 280 RT IVRL+STA TG+F+T R RQ PKLS +KYDPKV +RVLF E K Sbjct: 8 RTLIVRLISTAQTGFFYTTQRLRQGPKLSAIKYDPKVKQRVLFVESK 54 >gb|KXN92992.1| 54S ribosomal protein L39, mitochondrial, partial [Leucoagaricus sp. SymC.cos] Length = 52 Score = 63.9 bits (154), Expect = 1e-10 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = +2 Query: 140 RTTIVRLVSTAGTGYFFTKIRPRQLPKLSFVKYDPKVGRRVLFTE 274 RT IVRL+STA TG+F+T R RQ PKLS VKYDP VG+RVLF E Sbjct: 1 RTMIVRLISTAQTGFFYTTKRTRQGPKLSAVKYDPVVGQRVLFVE 45 >ref|XP_002174025.1| mitochondrial 54S ribosomal protein YmL39 [Schizosaccharomyces japonicus yFS275] gb|EEB07732.1| ribosomal protein subunit L39 [Schizosaccharomyces japonicus yFS275] Length = 55 Score = 63.9 bits (154), Expect = 1e-10 Identities = 25/44 (56%), Positives = 37/44 (84%) Frame = +2 Query: 149 IVRLVSTAGTGYFFTKIRPRQLPKLSFVKYDPKVGRRVLFTEQK 280 +++L+S+AGTGYF+ + R R PKL+F+KYDP++GRRV+F E K Sbjct: 10 LIKLLSSAGTGYFYVRSRARTAPKLNFIKYDPRIGRRVIFNEAK 53 >ref|NP_596108.1| mitochondrial ribosomal protein subunit L39 (predicted) [Schizosaccharomyces pombe] sp|O74394.1|RM39_SCHPO RecName: Full=54S ribosomal protein L39, mitochondrial emb|CAA20728.1| mitochondrial ribosomal protein subunit L39 (predicted) [Schizosaccharomyces pombe] Length = 55 Score = 63.9 bits (154), Expect = 1e-10 Identities = 26/44 (59%), Positives = 37/44 (84%) Frame = +2 Query: 149 IVRLVSTAGTGYFFTKIRPRQLPKLSFVKYDPKVGRRVLFTEQK 280 +V+L+STAGTG+F+ + RP+ PKL+F+KYDPK+ +RVLF E K Sbjct: 10 LVKLLSTAGTGFFYVRSRPKAAPKLAFIKYDPKIHKRVLFEESK 53 >gb|KJA13218.1| hypothetical protein HYPSUDRAFT_73122 [Hypholoma sublateritium FD-334 SS-4] Length = 59 Score = 63.9 bits (154), Expect = 1e-10 Identities = 33/47 (70%), Positives = 36/47 (76%) Frame = +2 Query: 140 RTTIVRLVSTAGTGYFFTKIRPRQLPKLSFVKYDPKVGRRVLFTEQK 280 RT IVRL+STA TG+F+T R RQ PKLS VKYDPKV RVLF E K Sbjct: 8 RTIIVRLISTAQTGFFYTTQRLRQGPKLSAVKYDPKVQARVLFVESK 54 >ref|XP_021868318.1| hypothetical protein BD324DRAFT_584122, partial [Kockovaella imperatae] gb|ORX34030.1| hypothetical protein BD324DRAFT_584122, partial [Kockovaella imperatae] Length = 51 Score = 63.5 bits (153), Expect = 1e-10 Identities = 33/47 (70%), Positives = 35/47 (74%) Frame = +2 Query: 140 RTTIVRLVSTAGTGYFFTKIRPRQLPKLSFVKYDPKVGRRVLFTEQK 280 R IVRLVSTA TGYF+T R R PKLSF+KYDPKV R VLF E K Sbjct: 1 RRIIVRLVSTALTGYFYTTTRLRTAPKLSFMKYDPKVRRHVLFMEGK 47 >gb|OAX41279.1| hypothetical protein K503DRAFT_735927, partial [Rhizopogon vinicolor AM-OR11-026] Length = 55 Score = 63.5 bits (153), Expect = 2e-10 Identities = 32/47 (68%), Positives = 36/47 (76%) Frame = +2 Query: 140 RTTIVRLVSTAGTGYFFTKIRPRQLPKLSFVKYDPKVGRRVLFTEQK 280 RT IVRL+STA TG+F+T RPRQ KL+ VKYDPKV RVLF E K Sbjct: 5 RTIIVRLISTAQTGFFYTTQRPRQGAKLAAVKYDPKVKARVLFVESK 51