BLASTX nr result
ID: Ophiopogon26_contig00052652
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00052652 (420 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC69636.1| hypothetical protein RhiirA1_415377, partial [Rhi... 140 5e-40 gb|PKK72684.1| hypothetical protein RhiirC2_742236, partial [Rhi... 140 6e-40 gb|PKC04151.1| hypothetical protein RhiirA5_362637 [Rhizophagus ... 140 1e-39 gb|PKY52500.1| hypothetical protein RhiirA4_408369 [Rhizophagus ... 139 5e-39 gb|EXX60716.1| hypothetical protein RirG_177330 [Rhizophagus irr... 140 7e-36 dbj|GBC39730.1| morphogenesis protein [Rhizophagus irregularis D... 140 7e-36 >gb|PKC69636.1| hypothetical protein RhiirA1_415377, partial [Rhizophagus irregularis] Length = 149 Score = 140 bits (353), Expect = 5e-40 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = +3 Query: 123 TIPTPGSFIAQRQMVLQGELPALKSLPKRTFQGLSHESKYNNSKLFPMQSSERLTYQRPS 302 TIPTPGSF+AQRQMVLQGELPALKSLPKRTFQGLSHESKYNNSKLFPMQSSERLTYQRPS Sbjct: 80 TIPTPGSFVAQRQMVLQGELPALKSLPKRTFQGLSHESKYNNSKLFPMQSSERLTYQRPS 139 Query: 303 ISPKVTQIKA 332 ISPKVTQIKA Sbjct: 140 ISPKVTQIKA 149 >gb|PKK72684.1| hypothetical protein RhiirC2_742236, partial [Rhizophagus irregularis] Length = 154 Score = 140 bits (353), Expect = 6e-40 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = +3 Query: 123 TIPTPGSFIAQRQMVLQGELPALKSLPKRTFQGLSHESKYNNSKLFPMQSSERLTYQRPS 302 TIPTPGSF+AQRQMVLQGELPALKSLPKRTFQGLSHESKYNNSKLFPMQSSERLTYQRPS Sbjct: 85 TIPTPGSFVAQRQMVLQGELPALKSLPKRTFQGLSHESKYNNSKLFPMQSSERLTYQRPS 144 Query: 303 ISPKVTQIKA 332 ISPKVTQIKA Sbjct: 145 ISPKVTQIKA 154 >gb|PKC04151.1| hypothetical protein RhiirA5_362637 [Rhizophagus irregularis] gb|PKY18626.1| hypothetical protein RhiirB3_405812 [Rhizophagus irregularis] Length = 183 Score = 140 bits (353), Expect = 1e-39 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = +3 Query: 123 TIPTPGSFIAQRQMVLQGELPALKSLPKRTFQGLSHESKYNNSKLFPMQSSERLTYQRPS 302 TIPTPGSF+AQRQMVLQGELPALKSLPKRTFQGLSHESKYNNSKLFPMQSSERLTYQRPS Sbjct: 114 TIPTPGSFVAQRQMVLQGELPALKSLPKRTFQGLSHESKYNNSKLFPMQSSERLTYQRPS 173 Query: 303 ISPKVTQIKA 332 ISPKVTQIKA Sbjct: 174 ISPKVTQIKA 183 >gb|PKY52500.1| hypothetical protein RhiirA4_408369 [Rhizophagus irregularis] Length = 193 Score = 139 bits (350), Expect = 5e-39 Identities = 68/70 (97%), Positives = 70/70 (100%) Frame = +3 Query: 123 TIPTPGSFIAQRQMVLQGELPALKSLPKRTFQGLSHESKYNNSKLFPMQSSERLTYQRPS 302 TIPTPGSF+AQRQMVLQGELPALKSLPKRTFQGLSHESKYNNSKLFPMQSSERLTYQRP+ Sbjct: 124 TIPTPGSFVAQRQMVLQGELPALKSLPKRTFQGLSHESKYNNSKLFPMQSSERLTYQRPT 183 Query: 303 ISPKVTQIKA 332 ISPKVTQIKA Sbjct: 184 ISPKVTQIKA 193 >gb|EXX60716.1| hypothetical protein RirG_177330 [Rhizophagus irregularis DAOM 197198w] Length = 933 Score = 140 bits (353), Expect = 7e-36 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = +3 Query: 123 TIPTPGSFIAQRQMVLQGELPALKSLPKRTFQGLSHESKYNNSKLFPMQSSERLTYQRPS 302 TIPTPGSF+AQRQMVLQGELPALKSLPKRTFQGLSHESKYNNSKLFPMQSSERLTYQRPS Sbjct: 864 TIPTPGSFVAQRQMVLQGELPALKSLPKRTFQGLSHESKYNNSKLFPMQSSERLTYQRPS 923 Query: 303 ISPKVTQIKA 332 ISPKVTQIKA Sbjct: 924 ISPKVTQIKA 933 >dbj|GBC39730.1| morphogenesis protein [Rhizophagus irregularis DAOM 181602] gb|POG81568.1| hypothetical protein GLOIN_2v1506359 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 960 Score = 140 bits (353), Expect = 7e-36 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = +3 Query: 123 TIPTPGSFIAQRQMVLQGELPALKSLPKRTFQGLSHESKYNNSKLFPMQSSERLTYQRPS 302 TIPTPGSF+AQRQMVLQGELPALKSLPKRTFQGLSHESKYNNSKLFPMQSSERLTYQRPS Sbjct: 891 TIPTPGSFVAQRQMVLQGELPALKSLPKRTFQGLSHESKYNNSKLFPMQSSERLTYQRPS 950 Query: 303 ISPKVTQIKA 332 ISPKVTQIKA Sbjct: 951 ISPKVTQIKA 960