BLASTX nr result
ID: Ophiopogon26_contig00052622
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00052622 (473 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY52509.1| hypothetical protein RhiirA4_470178 [Rhizophagus ... 65 3e-11 gb|EXX59798.1| hypothetical protein RirG_185810 [Rhizophagus irr... 65 3e-11 gb|POG66268.1| hypothetical protein GLOIN_2v1780765 [Rhizophagus... 65 6e-11 gb|PKC54110.1| hypothetical protein RhiirA1_477944 [Rhizophagus ... 64 2e-10 gb|PKC03008.1| hypothetical protein RhiirA5_424398 [Rhizophagus ... 63 2e-10 gb|PKY24578.1| hypothetical protein RhiirB3_527321 [Rhizophagus ... 63 2e-10 gb|PKY44991.1| hypothetical protein RhiirA4_459460 [Rhizophagus ... 63 3e-10 gb|PKC09693.1| hypothetical protein RhiirA5_415315 [Rhizophagus ... 62 6e-10 gb|POG68242.1| hypothetical protein GLOIN_2v1639346 [Rhizophagus... 61 1e-09 gb|PKC02690.1| hypothetical protein RhiirA5_503890 [Rhizophagus ... 61 2e-09 gb|PKK63949.1| hypothetical protein RhiirC2_854672 [Rhizophagus ... 60 2e-09 dbj|GBC13850.1| hypothetical protein RIR_0250400 [Rhizophagus ir... 59 1e-08 gb|EXX56812.1| hypothetical protein RirG_212780 [Rhizophagus irr... 56 1e-07 dbj|GBC33313.1| hypothetical protein RIR_1824600 [Rhizophagus ir... 56 1e-07 gb|PKC54158.1| hypothetical protein RhiirA1_542975 [Rhizophagus ... 55 2e-07 gb|PKC04874.1| hypothetical protein RhiirA5_421657 [Rhizophagus ... 54 4e-07 >gb|PKY52509.1| hypothetical protein RhiirA4_470178 [Rhizophagus irregularis] gb|PKY60158.1| hypothetical protein RhiirA4_483545 [Rhizophagus irregularis] gb|PKY63334.1| hypothetical protein RhiirA4_491871 [Rhizophagus irregularis] Length = 72 Score = 65.5 bits (158), Expect = 3e-11 Identities = 36/63 (57%), Positives = 41/63 (65%), Gaps = 10/63 (15%) Frame = +1 Query: 142 MKYLFWFIVLICIANSLTVYASPLSEVRSSHFVKRCS----LDSCG------NDDDCCIG 291 MKY+F FIVLIC + LTV+ASPL EVRSS +KRC+ L CG NDDDC G Sbjct: 1 MKYIFLFIVLICTIHGLTVHASPLHEVRSSLLMKRCTPGYGLGDCGVGEECVNDDDCSPG 60 Query: 292 LTC 300 L C Sbjct: 61 LYC 63 >gb|EXX59798.1| hypothetical protein RirG_185810 [Rhizophagus irregularis DAOM 197198w] dbj|GBC49646.1| JEMT01026200.1_cds_EXX59798.1_20232 [Rhizophagus irregularis DAOM 181602] Length = 72 Score = 65.5 bits (158), Expect = 3e-11 Identities = 37/70 (52%), Positives = 43/70 (61%), Gaps = 12/70 (17%) Frame = +1 Query: 142 MKYLFWFIVLICIANSLTVYASPLSEVRSSHFVKRCSL----------DSCGNDDDCCIG 291 MKY+F FIVLIC + LTV+ASPL EVRSS +KRC+ D C ND+DC G Sbjct: 1 MKYIFLFIVLICTIHGLTVHASPLHEVRSSLLMKRCTPGFGLGDCGVGDECVNDNDCSPG 60 Query: 292 LTC--IFGYC 315 L C I G C Sbjct: 61 LYCDTIAGVC 70 >gb|POG66268.1| hypothetical protein GLOIN_2v1780765 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 72 Score = 64.7 bits (156), Expect = 6e-11 Identities = 38/70 (54%), Positives = 43/70 (61%), Gaps = 12/70 (17%) Frame = +1 Query: 142 MKYLFWFIVLICIANSLTVYASPLSEVRSSHFVKRCS----LDSCG------NDDDCCIG 291 MKY+F FIVLIC + LTV+ASPL EVRSS +KRC+ L CG DDDC G Sbjct: 1 MKYIFLFIVLICTIHGLTVHASPLHEVRSSLLMKRCTTGGQLGDCGIGGECVTDDDCLPG 60 Query: 292 LTC--IFGYC 315 L C I G C Sbjct: 61 LYCDTIVGVC 70 >gb|PKC54110.1| hypothetical protein RhiirA1_477944 [Rhizophagus irregularis] Length = 72 Score = 63.5 bits (153), Expect = 2e-10 Identities = 36/70 (51%), Positives = 41/70 (58%), Gaps = 12/70 (17%) Frame = +1 Query: 142 MKYLFWFIVLICIANSLTVYASPLSEVRSSHFVKRCSL----------DSCGNDDDCCIG 291 MKY+F FIVLIC + LTV+ASPL EVRSS +KRC+ C DDDC G Sbjct: 1 MKYIFLFIVLICTIHGLTVHASPLHEVRSSLLMKRCTTGGQLGDCVIGGECVTDDDCLPG 60 Query: 292 LTC--IFGYC 315 L C I G C Sbjct: 61 LYCNTIVGVC 70 >gb|PKC03008.1| hypothetical protein RhiirA5_424398 [Rhizophagus irregularis] gb|PKC56935.1| hypothetical protein RhiirA1_473273 [Rhizophagus irregularis] gb|PKC62134.1| hypothetical protein RhiirA1_465568 [Rhizophagus irregularis] Length = 70 Score = 63.2 bits (152), Expect = 2e-10 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 5/63 (7%) Frame = +1 Query: 142 MKYLFWFIVLICIANSLTVYASPLSEVRSSHFVKRCS----LDSCGNDDDCCIGLTCIFG 309 MKY+F FIVLIC + LTV+ASPL EVRSSH +KRC+ CG C C+ G Sbjct: 1 MKYIFLFIVLICTIHGLTVHASPLKEVRSSHLMKRCTPGGFRGDCGAGQPCQFNGDCMMG 60 Query: 310 -YC 315 YC Sbjct: 61 LYC 63 >gb|PKY24578.1| hypothetical protein RhiirB3_527321 [Rhizophagus irregularis] Length = 71 Score = 63.2 bits (152), Expect = 2e-10 Identities = 32/63 (50%), Positives = 41/63 (65%), Gaps = 5/63 (7%) Frame = +1 Query: 142 MKYLFWFIVLICIANSLTVYASPLSEVRSSHFVKRCSLD----SCGNDDDCCIGLTCIFG 309 MKY+F FI+LIC + LTV+ASPL EVRSS +KRC+ CG D++C C +G Sbjct: 1 MKYIFLFIILICTIHGLTVHASPLHEVRSSLLMKRCTPGGFNRDCGYDEECETDFDCAYG 60 Query: 310 -YC 315 YC Sbjct: 61 LYC 63 >gb|PKY44991.1| hypothetical protein RhiirA4_459460 [Rhizophagus irregularis] Length = 70 Score = 62.8 bits (151), Expect = 3e-10 Identities = 32/63 (50%), Positives = 39/63 (61%), Gaps = 5/63 (7%) Frame = +1 Query: 142 MKYLFWFIVLICIANSLTVYASPLSEVRSSHFVKRCS----LDSCGNDDDCCIGLTCIFG 309 MKY+F F+VLIC + LTV+ASPL EVRSSH +KRC+ CG C C+ G Sbjct: 1 MKYIFLFVVLICTIHGLTVHASPLKEVRSSHLMKRCTPGGFRGDCGAGQPCQFNGDCMMG 60 Query: 310 -YC 315 YC Sbjct: 61 LYC 63 >gb|PKC09693.1| hypothetical protein RhiirA5_415315 [Rhizophagus irregularis] gb|PKY31384.1| hypothetical protein RhiirB3_448962 [Rhizophagus irregularis] Length = 72 Score = 62.0 bits (149), Expect = 6e-10 Identities = 37/70 (52%), Positives = 42/70 (60%), Gaps = 12/70 (17%) Frame = +1 Query: 142 MKYLFWFIVLICIANSLTVYASPLSEVRSSHFVKRCS----LDSCG------NDDDCCIG 291 MKY+F FIVLIC + LTV+ASP EVRSS +KRC+ L CG DDDC G Sbjct: 1 MKYIFLFIVLICTIHGLTVHASPHHEVRSSLLMKRCTTGGQLGDCGIGGECVTDDDCLPG 60 Query: 292 LTC--IFGYC 315 L C I G C Sbjct: 61 LYCDTIVGVC 70 >gb|POG68242.1| hypothetical protein GLOIN_2v1639346 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 60 Score = 61.2 bits (147), Expect = 1e-09 Identities = 33/59 (55%), Positives = 39/59 (66%), Gaps = 1/59 (1%) Frame = +1 Query: 142 MKYLFWFIVLICIANSLTVYASPLSEVRSSHFVKRCSLDSCGNDDDC-CIGLTCIFGYC 315 MKYLFWFIVL+CIA SLTV+ASPL + VKRCS C +D+DC + C G C Sbjct: 1 MKYLFWFIVLVCIATSLTVHASPLDPL-----VKRCSA-PCSSDEDCGDVNFQCEDGCC 53 >gb|PKC02690.1| hypothetical protein RhiirA5_503890 [Rhizophagus irregularis] gb|PKC59405.1| hypothetical protein RhiirA1_540505 [Rhizophagus irregularis] Length = 71 Score = 60.8 bits (146), Expect = 2e-09 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 5/63 (7%) Frame = +1 Query: 142 MKYLFWFIVLICIANSLTVYASPLSEVRSSHFVKRCSLD----SCGNDDDCCIGLTCIFG 309 MKY+F FI+LIC + LTV+A PL EVRSS +KRC+ CG D++C C +G Sbjct: 1 MKYIFLFIILICTIHGLTVHALPLHEVRSSLLMKRCTPGGFNRDCGYDEECETDFDCAYG 60 Query: 310 -YC 315 YC Sbjct: 61 LYC 63 >gb|PKK63949.1| hypothetical protein RhiirC2_854672 [Rhizophagus irregularis] Length = 71 Score = 60.5 bits (145), Expect = 2e-09 Identities = 32/63 (50%), Positives = 40/63 (63%), Gaps = 5/63 (7%) Frame = +1 Query: 142 MKYLFWFIVLICIANSLTVYASPLSEVRSSHFVKRCSLD----SCGNDDDCCIGLTCIFG 309 MKY+F FI+LIC +SLTV+A PL EVRSS +KRC+ CG D+ C C +G Sbjct: 1 MKYIFLFIILICTIHSLTVHALPLHEVRSSLLMKRCTPGGFNRDCGYDEVCETDFDCAYG 60 Query: 310 -YC 315 YC Sbjct: 61 LYC 63 >dbj|GBC13850.1| hypothetical protein RIR_0250400 [Rhizophagus irregularis DAOM 181602] gb|POG60810.1| hypothetical protein GLOIN_2v1709706 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 71 Score = 58.9 bits (141), Expect = 1e-08 Identities = 31/63 (49%), Positives = 39/63 (61%), Gaps = 5/63 (7%) Frame = +1 Query: 142 MKYLFWFIVLICIANSLTVYASPLSEVRSSHFVKRCSLD----SCGNDDDCCIGLTCIFG 309 MKY+F FI+LIC + LTV+A PL EVRSS +KRC+ CG D+ C C +G Sbjct: 1 MKYIFLFIILICTIHGLTVHALPLHEVRSSLLMKRCTPGGFNRDCGYDEVCETDFDCAYG 60 Query: 310 -YC 315 YC Sbjct: 61 LYC 63 >gb|EXX56812.1| hypothetical protein RirG_212780 [Rhizophagus irregularis DAOM 197198w] dbj|GBC21799.1| JEMT01027516.1_cds_EXX56812.1_23219: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 70 Score = 56.2 bits (134), Expect = 1e-07 Identities = 30/63 (47%), Positives = 37/63 (58%), Gaps = 10/63 (15%) Frame = +1 Query: 142 MKYLFWFIVLICIANSLTVYASPLSEVRSSHFVKRCSL----------DSCGNDDDCCIG 291 MKY+ FIVLIC + LTV+ASPL VRSSH +KRC+ C + DC +G Sbjct: 1 MKYISLFIVLICTIHGLTVHASPLKVVRSSHLMKRCTPGGFRGDCSAGQPCQFNGDCMMG 60 Query: 292 LTC 300 L C Sbjct: 61 LYC 63 >dbj|GBC33313.1| hypothetical protein RIR_1824600 [Rhizophagus irregularis DAOM 181602] gb|PKY35333.1| hypothetical protein RhiirB3_533146 [Rhizophagus irregularis] gb|POG79706.1| hypothetical protein GLOIN_2v1525152 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 69 Score = 55.8 bits (133), Expect = 1e-07 Identities = 32/63 (50%), Positives = 39/63 (61%), Gaps = 10/63 (15%) Frame = +1 Query: 142 MKYLFWFIVLICIANSLTVYASPLSEVRSSHFVKRCSL----------DSCGNDDDCCIG 291 MKY+F FIVLIC + LTV+ASPL EVR+S +KRC+ + C DDDC G Sbjct: 1 MKYIFLFIVLICTIH-LTVHASPLHEVRTSLLMKRCTHGGGLGDCNKGEECFFDDDCAPG 59 Query: 292 LTC 300 L C Sbjct: 60 LYC 62 >gb|PKC54158.1| hypothetical protein RhiirA1_542975 [Rhizophagus irregularis] Length = 69 Score = 55.5 bits (132), Expect = 2e-07 Identities = 32/63 (50%), Positives = 39/63 (61%), Gaps = 10/63 (15%) Frame = +1 Query: 142 MKYLFWFIVLICIANSLTVYASPLSEVRSSHFVKRCSL----------DSCGNDDDCCIG 291 MKY+F FIVLIC + LTV+ASPL EVR+S +KRC+ + C DDDC G Sbjct: 1 MKYIFLFIVLICTIH-LTVHASPLHEVRTSLLMKRCTHGGGLGDCNKGEECFFDDDCVPG 59 Query: 292 LTC 300 L C Sbjct: 60 LYC 62 >gb|PKC04874.1| hypothetical protein RhiirA5_421657 [Rhizophagus irregularis] gb|PKK76188.1| hypothetical protein RhiirC2_734936 [Rhizophagus irregularis] gb|POG68917.1| hypothetical protein GLOIN_2v1777740 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 58 Score = 54.3 bits (129), Expect = 4e-07 Identities = 24/49 (48%), Positives = 35/49 (71%), Gaps = 2/49 (4%) Frame = +1 Query: 142 MKYLFWFIVLICIANSLTVYASPLSEVRSSHFVKRCSLD--SCGNDDDC 282 MK+LFWFI L+ I +++TV+ASP+ EV+ S +KRC+ CG+ D C Sbjct: 1 MKFLFWFIALVFIVHAMTVHASPIREVKYSELMKRCNDGGAGCGSGDGC 49