BLASTX nr result
ID: Ophiopogon26_contig00052609
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00052609 (360 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX72908.1| hypothetical protein RirG_064970 [Rhizophagus irr... 70 2e-11 gb|PKC72913.1| hypothetical protein RhiirA1_411205, partial [Rhi... 67 1e-10 gb|PKC15725.1| hypothetical protein RhiirA5_348739, partial [Rhi... 52 5e-06 >gb|EXX72908.1| hypothetical protein RirG_064970 [Rhizophagus irregularis DAOM 197198w] dbj|GBC44242.1| hypothetical protein RIR_2705100 [Rhizophagus irregularis DAOM 181602] gb|POG83245.1| hypothetical protein GLOIN_2v1469382 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 472 Score = 69.7 bits (169), Expect = 2e-11 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = +1 Query: 91 YKSIQFHLQTSLHGVKKIVLKEMVTLDYMAVGKNILKRDSQLVCFFFPFND 243 YK ++ HLQT H VK I +K M T++Y+AVGK+ILKRDSQ+VCFFFP +D Sbjct: 423 YKDVKLHLQTQ-HDVKNISMKWMTTINYLAVGKSILKRDSQVVCFFFPLDD 472 >gb|PKC72913.1| hypothetical protein RhiirA1_411205, partial [Rhizophagus irregularis] Length = 376 Score = 67.4 bits (163), Expect = 1e-10 Identities = 31/50 (62%), Positives = 40/50 (80%) Frame = +1 Query: 91 YKSIQFHLQTSLHGVKKIVLKEMVTLDYMAVGKNILKRDSQLVCFFFPFN 240 YK ++ HLQT H VK I +K M T++Y+AVGK+ILKRDSQ+VCFFFP + Sbjct: 328 YKDVKLHLQTQ-HDVKNISMKWMTTINYLAVGKSILKRDSQVVCFFFPLD 376 >gb|PKC15725.1| hypothetical protein RhiirA5_348739, partial [Rhizophagus irregularis] gb|PKY14880.1| hypothetical protein RhiirB3_400894, partial [Rhizophagus irregularis] Length = 135 Score = 52.4 bits (124), Expect = 5e-06 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = +1 Query: 91 YKSIQFHLQTSLHGVKKIVLKEMVTLDYMAVGKNILKRDSQL 216 YK ++ HLQT H VK I +K M T++Y+AVGK+ILKRDSQ+ Sbjct: 95 YKDVKLHLQTQ-HDVKNISMKWMTTINYLAVGKSILKRDSQV 135