BLASTX nr result
ID: Ophiopogon26_contig00052595
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00052595 (782 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY19537.1| hypothetical protein RhiirB3_523584 [Rhizophagus ... 74 2e-11 gb|EXX63444.1| hypothetical protein RirG_152290 [Rhizophagus irr... 69 3e-10 gb|PKK63426.1| hypothetical protein RhiirC2_855019 [Rhizophagus ... 61 1e-07 >gb|PKY19537.1| hypothetical protein RhiirB3_523584 [Rhizophagus irregularis] Length = 518 Score = 74.3 bits (181), Expect = 2e-11 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = -3 Query: 318 VWYIMDGQHPTKYDVKTILVSSLKKNHYKNFDKWGRNW 205 VWYI+DGQHPT+YD KTI+VSS +K+HYK+FDKWGR+W Sbjct: 186 VWYIVDGQHPTEYDAKTIVVSSPEKSHYKDFDKWGRSW 223 >gb|EXX63444.1| hypothetical protein RirG_152290 [Rhizophagus irregularis DAOM 197198w] dbj|GBC18883.1| hypothetical protein RIR_0656000 [Rhizophagus irregularis DAOM 181602] Length = 212 Score = 68.6 bits (166), Expect = 3e-10 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = -3 Query: 318 VWYIMDGQHPTKYDVKTILVSSLKKNHYKNFDKWGR 211 VWYI+DGQHPT+YD KTI+VSS +K+HYK+FDKWG+ Sbjct: 13 VWYIVDGQHPTEYDAKTIVVSSPEKSHYKDFDKWGK 48 >gb|PKK63426.1| hypothetical protein RhiirC2_855019 [Rhizophagus irregularis] Length = 218 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -3 Query: 318 VWYIMDGQHPTKYDVKTILVSSLKKNHYKNFDK 220 VWYI+DGQHPT+YD KTI+VSS +K+HYK+FDK Sbjct: 186 VWYIVDGQHPTEYDAKTIVVSSPEKSHYKDFDK 218