BLASTX nr result
ID: Ophiopogon26_contig00052541
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00052541 (620 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX74100.1| hypothetical protein RirG_054280 [Rhizophagus irr... 55 4e-06 >gb|EXX74100.1| hypothetical protein RirG_054280 [Rhizophagus irregularis DAOM 197198w] dbj|GBC35304.1| hypothetical protein RIR_1989700 [Rhizophagus irregularis DAOM 181602] gb|PKC60288.1| hypothetical protein RhiirA1_426080 [Rhizophagus irregularis] gb|PKY29216.1| hypothetical protein RhiirB3_417805 [Rhizophagus irregularis] Length = 135 Score = 54.7 bits (130), Expect = 4e-06 Identities = 35/73 (47%), Positives = 44/73 (60%), Gaps = 1/73 (1%) Frame = +1 Query: 340 PNMQRRASES-TSITEFKKSPMMRRYTLPSRIIPFGPTIGGENNPRSPFAMFWEVGAGRE 516 PN+QRRASES T +FKK P +RRYTLP ++ + FWE AGR+ Sbjct: 80 PNLQRRASESITEAVQFKKLP-VRRYTLPGKL---------------GLSKFWE--AGRD 121 Query: 517 SSVRAAMDNFQFG 555 SSV+ AMD+ QFG Sbjct: 122 SSVQVAMDHCQFG 134