BLASTX nr result
ID: Ophiopogon26_contig00052538
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00052538 (556 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC31446.1| hypothetical protein RIR_1677600 [Rhizophagus ir... 53 5e-07 dbj|GBC31447.1| hypothetical protein RIR_1677600 [Rhizophagus ir... 53 5e-07 dbj|GBC31448.1| hypothetical protein RIR_1677600 [Rhizophagus ir... 53 6e-07 >dbj|GBC31446.1| hypothetical protein RIR_1677600 [Rhizophagus irregularis DAOM 181602] Length = 186 Score = 52.8 bits (125), Expect(2) = 5e-07 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +1 Query: 235 ESDAGANYCTCRIKSIDENGHILSLLPFSVKHSLRI*LHNT 357 ESDAGA Y TCRIK+ DENGHILSLLPF ++ LHN+ Sbjct: 21 ESDAGAIYYTCRIKNFDENGHILSLLPFG---EVKKQLHNS 58 Score = 28.5 bits (62), Expect(2) = 5e-07 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 459 HNSNYDNTSEK 491 HNSNYDNTSEK Sbjct: 56 HNSNYDNTSEK 66 >dbj|GBC31447.1| hypothetical protein RIR_1677600 [Rhizophagus irregularis DAOM 181602] Length = 185 Score = 52.8 bits (125), Expect(2) = 5e-07 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +1 Query: 235 ESDAGANYCTCRIKSIDENGHILSLLPFSVKHSLRI*LHNT 357 ESDAGA Y TCRIK+ DENGHILSLLPF ++ LHN+ Sbjct: 21 ESDAGAIYYTCRIKNFDENGHILSLLPFG---EVKKQLHNS 58 Score = 28.5 bits (62), Expect(2) = 5e-07 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 459 HNSNYDNTSEK 491 HNSNYDNTSEK Sbjct: 56 HNSNYDNTSEK 66 >dbj|GBC31448.1| hypothetical protein RIR_1677600 [Rhizophagus irregularis DAOM 181602] Length = 139 Score = 52.8 bits (125), Expect(2) = 6e-07 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +1 Query: 235 ESDAGANYCTCRIKSIDENGHILSLLPFSVKHSLRI*LHNT 357 ESDAGA Y TCRIK+ DENGHILSLLPF ++ LHN+ Sbjct: 21 ESDAGAIYYTCRIKNFDENGHILSLLPFG---EVKKQLHNS 58 Score = 28.5 bits (62), Expect(2) = 6e-07 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 459 HNSNYDNTSEK 491 HNSNYDNTSEK Sbjct: 56 HNSNYDNTSEK 66