BLASTX nr result
ID: Ophiopogon26_contig00052325
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00052325 (601 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC53252.1| hypothetical protein RIR_3448400 [Rhizophagus ir... 55 1e-06 >dbj|GBC53252.1| hypothetical protein RIR_3448400 [Rhizophagus irregularis DAOM 181602] Length = 84 Score = 54.7 bits (130), Expect = 1e-06 Identities = 40/92 (43%), Positives = 47/92 (51%), Gaps = 2/92 (2%) Frame = +1 Query: 127 NKTKNLLRYYFCQAHTMILDGLTLRIRQTSY*YFIQAVLYLFVNILE--L*IWLV*V*NN 300 NKTKNLLR YF +VLYLF N+LE I + V N+ Sbjct: 17 NKTKNLLRDYF-------------------------SVLYLFGNVLEPKFKIMVHIVPND 51 Query: 301 GTYCT*RYIFSYEHSMFTTFNLLGFN*RNYLK 396 ++C +HSMFTTFNLLGFN RNYLK Sbjct: 52 TSFC-----LRMKHSMFTTFNLLGFNWRNYLK 78