BLASTX nr result
ID: Ophiopogon26_contig00052302
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00052302 (426 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY45452.1| hypothetical protein RhiirA4_401244 [Rhizophagus ... 94 6e-21 gb|EXX72095.1| hypothetical protein RirG_072510 [Rhizophagus irr... 91 5e-20 >gb|PKY45452.1| hypothetical protein RhiirA4_401244 [Rhizophagus irregularis] Length = 207 Score = 93.6 bits (231), Expect = 6e-21 Identities = 45/59 (76%), Positives = 50/59 (84%) Frame = -3 Query: 424 FRYNGHEKDICGLCIEWPVRNYGDGYIKVQPDGNLIISAIQGNRPVTIDNKNRSFKRPR 248 F YN +K+ICG IEWPV+NYGDGYIKVQPDGNLIISA QGNRP+TID KNR+ KR R Sbjct: 148 FCYNYKKKEICGPYIEWPVKNYGDGYIKVQPDGNLIISATQGNRPITID-KNRALKRLR 205 >gb|EXX72095.1| hypothetical protein RirG_072510 [Rhizophagus irregularis DAOM 197198w] dbj|GBC41101.1| hypothetical protein RIR_2456600 [Rhizophagus irregularis DAOM 181602] gb|PKC13413.1| hypothetical protein RhiirA5_459380 [Rhizophagus irregularis] gb|PKC72113.1| hypothetical protein RhiirA1_531473 [Rhizophagus irregularis] gb|PKY19656.1| hypothetical protein RhiirB3_495324 [Rhizophagus irregularis] gb|POG59943.1| hypothetical protein GLOIN_2v1717524 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 207 Score = 91.3 bits (225), Expect = 5e-20 Identities = 44/59 (74%), Positives = 49/59 (83%) Frame = -3 Query: 424 FRYNGHEKDICGLCIEWPVRNYGDGYIKVQPDGNLIISAIQGNRPVTIDNKNRSFKRPR 248 F YN +K+ICG IEWPV+NYGDGYIKVQPDGNLIISA Q NRP+TID KNR+ KR R Sbjct: 148 FCYNDKKKEICGPYIEWPVKNYGDGYIKVQPDGNLIISATQRNRPITID-KNRALKRLR 205