BLASTX nr result
ID: Ophiopogon26_contig00052300
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00052300 (693 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY38816.1| hypothetical protein RhiirA4_439631 [Rhizophagus ... 64 1e-14 gb|PKC72747.1| hypothetical protein RhiirA1_451929, partial [Rhi... 63 6e-08 >gb|PKY38816.1| hypothetical protein RhiirA4_439631 [Rhizophagus irregularis] Length = 142 Score = 63.5 bits (153), Expect(2) = 1e-14 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 192 FRKEICKEVRKEIRDAVKEINGRRSTNYRS 103 FRKEICKEVRKEIRDAVKEINGRRSTNYRS Sbjct: 113 FRKEICKEVRKEIRDAVKEINGRRSTNYRS 142 Score = 44.7 bits (104), Expect(2) = 1e-14 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = -2 Query: 359 TRKTDTLRQSTISSTIPEQQFDLEKL 282 T + DTL QSTISSTIPEQQFDLEKL Sbjct: 54 TTQQDTLLQSTISSTIPEQQFDLEKL 79 >gb|PKC72747.1| hypothetical protein RhiirA1_451929, partial [Rhizophagus irregularis] Length = 362 Score = 63.2 bits (152), Expect = 6e-08 Identities = 32/49 (65%), Positives = 34/49 (69%) Frame = -3 Query: 490 WKKRFLTIAEQINKDERFIKKIKDEKTDKSFWQYIEDTQKLELLRERQI 344 WK F T ++ IKDEKTDKSFWQYIEDTQKLELLRERQI Sbjct: 308 WKPHFRTSSDFEGAPSGCRPVIKDEKTDKSFWQYIEDTQKLELLRERQI 356