BLASTX nr result
ID: Ophiopogon26_contig00052129
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00052129 (402 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX51129.1| hypothetical protein RirG_264500 [Rhizophagus irr... 128 2e-36 >gb|EXX51129.1| hypothetical protein RirG_264500 [Rhizophagus irregularis DAOM 197198w] dbj|GBC14457.1| hypothetical protein RIR_0300100 [Rhizophagus irregularis DAOM 181602] gb|PKK75459.1| hypothetical protein RhiirC2_736594 [Rhizophagus irregularis] gb|PKY42720.1| hypothetical protein RhiirA4_397863 [Rhizophagus irregularis] Length = 78 Score = 128 bits (322), Expect = 2e-36 Identities = 65/81 (80%), Positives = 68/81 (83%), Gaps = 9/81 (11%) Frame = +2 Query: 5 MTDKPLPQIPKDEK---------HHLTNNDTKQIEKSNHPHLTAAKEVLSDAVHNAAQTL 157 M+DKPLPQIPKDEK HHLTN QIEKSNHPHLTAAKEVLSDAVH+AAQTL Sbjct: 1 MSDKPLPQIPKDEKEKSNNDPEKHHLTNT---QIEKSNHPHLTAAKEVLSDAVHHAAQTL 57 Query: 158 KVEPKESHPEAYHQDGKSGPE 220 K+EPKESHPEAYHQDGKSGPE Sbjct: 58 KIEPKESHPEAYHQDGKSGPE 78