BLASTX nr result
ID: Ophiopogon26_contig00052104
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00052104 (469 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX63137.1| hypothetical protein RirG_155190 [Rhizophagus irr... 106 4e-27 gb|PKC06124.1| hypothetical protein RhiirA5_420002 [Rhizophagus ... 80 3e-16 gb|PKY59829.1| hypothetical protein RhiirA4_482926, partial [Rhi... 79 3e-16 gb|PKY62885.1| hypothetical protein RhiirA4_490240, partial [Rhi... 77 5e-16 gb|POG57701.1| hypothetical protein GLOIN_2v1737637, partial [Rh... 80 5e-16 gb|EXX50810.1| Ypk2p [Rhizophagus irregularis DAOM 197198w] 84 8e-16 dbj|GBC40428.1| serine/threonine protein kinase [Rhizophagus irr... 84 8e-16 gb|POG81756.1| hypothetical protein GLOIN_2v1505060 [Rhizophagus... 79 1e-15 gb|PKC06126.1| hypothetical protein RhiirA5_420004 [Rhizophagus ... 83 2e-15 dbj|GBC40461.1| serine/threonine protein kinase [Rhizophagus irr... 83 2e-15 gb|EXX64349.1| Ypk2p [Rhizophagus irregularis DAOM 197198w] 81 4e-15 gb|PKK60809.1| kinase-like protein [Rhizophagus irregularis] 82 5e-15 gb|POG67169.1| hypothetical protein GLOIN_2v1650137, partial [Rh... 78 5e-15 dbj|GBC11175.1| serine/threonine protein kinase [Rhizophagus irr... 82 5e-15 gb|POG65200.1| kinase-like domain-containing protein [Rhizophagu... 81 7e-15 gb|PKC67989.1| kinase-like protein [Rhizophagus irregularis] 81 7e-15 dbj|GBC40463.1| serine/threonine protein kinase [Rhizophagus irr... 81 7e-15 gb|PKC00435.1| hypothetical protein RhiirA5_428193 [Rhizophagus ... 81 7e-15 dbj|GBC52497.1| serine/threonine protein kinase [Rhizophagus irr... 81 7e-15 dbj|GBC31037.1| serine/threonine protein kinase [Rhizophagus irr... 81 9e-15 >gb|EXX63137.1| hypothetical protein RirG_155190 [Rhizophagus irregularis DAOM 197198w] gb|POG63495.1| hypothetical protein GLOIN_2v1784009 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 95 Score = 106 bits (265), Expect = 4e-27 Identities = 52/63 (82%), Positives = 59/63 (93%) Frame = +1 Query: 1 AIYTSRLLVFDNLPEPKNSYDYYDQSDNIISNEFSESLQIDISRLKINDEQMDGDKEEME 180 AIYT+RLL FDNLP+PKNS DYYDQS+NIISNEFSESLQI+IS+L INDEQ+D DK+EME Sbjct: 33 AIYTNRLLDFDNLPKPKNSDDYYDQSNNIISNEFSESLQINISQLNINDEQIDEDKKEME 92 Query: 181 MSP 189 MSP Sbjct: 93 MSP 95 >gb|PKC06124.1| hypothetical protein RhiirA5_420002 [Rhizophagus irregularis] Length = 119 Score = 79.7 bits (195), Expect = 3e-16 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = +1 Query: 1 AIYTSRLLVFDNLPEPKNSYDYYDQSDNIISNEFSESLQIDISRLKIN 144 AIYTSRLL F+NLPEPKNS DYY+Q+DNIIS +FSESLQIDIS+L IN Sbjct: 68 AIYTSRLLDFNNLPEPKNSDDYYEQNDNIISEKFSESLQIDISQLDIN 115 >gb|PKY59829.1| hypothetical protein RhiirA4_482926, partial [Rhizophagus irregularis] Length = 96 Score = 79.0 bits (193), Expect = 3e-16 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = +1 Query: 1 AIYTSRLLVFDNLPEPKNSYDYYDQSDNIISNEFSESLQIDISRLKINDEQ 153 AIYTSRLL F+NLPEPKNS DYY ++DNIIS EFSESLQI+IS+L IN+ + Sbjct: 18 AIYTSRLLSFNNLPEPKNSDDYYKRNDNIISKEFSESLQINISQLNINENE 68 >gb|PKY62885.1| hypothetical protein RhiirA4_490240, partial [Rhizophagus irregularis] Length = 61 Score = 77.4 bits (189), Expect = 5e-16 Identities = 40/59 (67%), Positives = 49/59 (83%), Gaps = 1/59 (1%) Frame = +1 Query: 4 IYTSRLLVFDNLPEPKNSYDYYDQ-SDNIISNEFSESLQIDISRLKINDEQMDGDKEEM 177 +YTSRLL F+NLPEPKNS DYYD+ +DNIIS +FSESLQI+IS+LKI+D + EEM Sbjct: 1 VYTSRLLNFNNLPEPKNSDDYYDERNDNIISEKFSESLQINISQLKISDANETKNVEEM 59 >gb|POG57701.1| hypothetical protein GLOIN_2v1737637, partial [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 159 Score = 80.1 bits (196), Expect = 5e-16 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 1/50 (2%) Frame = +1 Query: 1 AIYTSRLLVFDNLPEPKNSYDYY-DQSDNIISNEFSESLQIDISRLKIND 147 AIYTSRLL F+NLPEPKNS DYY +Q+DNIIS +FSESLQIDISRLKIN+ Sbjct: 109 AIYTSRLLSFNNLPEPKNSDDYYNEQNDNIISEKFSESLQIDISRLKINE 158 >gb|EXX50810.1| Ypk2p [Rhizophagus irregularis DAOM 197198w] Length = 881 Score = 84.0 bits (206), Expect = 8e-16 Identities = 40/58 (68%), Positives = 49/58 (84%) Frame = +1 Query: 1 AIYTSRLLVFDNLPEPKNSYDYYDQSDNIISNEFSESLQIDISRLKINDEQMDGDKEE 174 A+Y+SRLL ++NLPEPKNS DYY Q+DNIIS EFS+SLQIDISRLKIND ++ + E Sbjct: 816 AVYSSRLLSYNNLPEPKNSDDYYKQNDNIISTEFSDSLQIDISRLKINDNTINVENPE 873 >dbj|GBC40428.1| serine/threonine protein kinase [Rhizophagus irregularis DAOM 181602] Length = 889 Score = 84.0 bits (206), Expect = 8e-16 Identities = 40/58 (68%), Positives = 49/58 (84%) Frame = +1 Query: 1 AIYTSRLLVFDNLPEPKNSYDYYDQSDNIISNEFSESLQIDISRLKINDEQMDGDKEE 174 A+Y+SRLL ++NLPEPKNS DYY Q+DNIIS EFS+SLQIDISRLKIND ++ + E Sbjct: 816 AVYSSRLLSYNNLPEPKNSDDYYKQNDNIISTEFSDSLQIDISRLKINDNTINVENPE 873 >gb|POG81756.1| hypothetical protein GLOIN_2v1505060 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 156 Score = 79.3 bits (194), Expect = 1e-15 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 1/60 (1%) Frame = +1 Query: 1 AIYTSRLLVFDNLPEPKNSYDYYDQ-SDNIISNEFSESLQIDISRLKINDEQMDGDKEEM 177 A+YTSRLL F+NLPEPKNS DYYD+ +DNIIS FSESLQI+IS+LKI+D + + EEM Sbjct: 95 AVYTSRLLNFNNLPEPKNSDDYYDERNDNIISENFSESLQINISQLKISDAEETKNVEEM 154 >gb|PKC06126.1| hypothetical protein RhiirA5_420004 [Rhizophagus irregularis] Length = 1546 Score = 82.8 bits (203), Expect = 2e-15 Identities = 47/70 (67%), Positives = 52/70 (74%), Gaps = 10/70 (14%) Frame = +1 Query: 1 AIYTSRLLVFDNLPEPKNSYDYYDQSDNIISNEFSESLQIDISRL--------KINDEQM 156 AIYTSRLL F+NLPEPKNS DYY+Q+DNIISNEFSESLQIDIS+L K +DEQ Sbjct: 1431 AIYTSRLLSFNNLPEPKNSDDYYEQNDNIISNEFSESLQIDISQLNNNKMPKIKNSDEQY 1490 Query: 157 DG--DKEEME 180 D KE E Sbjct: 1491 DNIISKESSE 1500 >dbj|GBC40461.1| serine/threonine protein kinase [Rhizophagus irregularis DAOM 181602] Length = 1696 Score = 82.8 bits (203), Expect = 2e-15 Identities = 47/70 (67%), Positives = 52/70 (74%), Gaps = 10/70 (14%) Frame = +1 Query: 1 AIYTSRLLVFDNLPEPKNSYDYYDQSDNIISNEFSESLQIDISRL--------KINDEQM 156 AIYTSRLL F+NLPEPKNS DYY+Q+DNIISNEFSESLQIDIS+L K +DEQ Sbjct: 1581 AIYTSRLLSFNNLPEPKNSDDYYEQNDNIISNEFSESLQIDISQLNNNKMPKIKNSDEQY 1640 Query: 157 DG--DKEEME 180 D KE E Sbjct: 1641 DNIISKESSE 1650 >gb|EXX64349.1| Ypk2p [Rhizophagus irregularis DAOM 197198w] Length = 350 Score = 81.3 bits (199), Expect = 4e-15 Identities = 39/51 (76%), Positives = 45/51 (88%) Frame = +1 Query: 1 AIYTSRLLVFDNLPEPKNSYDYYDQSDNIISNEFSESLQIDISRLKINDEQ 153 AIYTSRLL F+NLPEPKNS DYY+Q DNIIS EFSESLQI+IS+L IN+ + Sbjct: 255 AIYTSRLLSFNNLPEPKNSVDYYEQIDNIISKEFSESLQINISQLNINENE 305 >gb|PKK60809.1| kinase-like protein [Rhizophagus irregularis] Length = 503 Score = 81.6 bits (200), Expect = 5e-15 Identities = 41/54 (75%), Positives = 46/54 (85%) Frame = +1 Query: 1 AIYTSRLLVFDNLPEPKNSYDYYDQSDNIISNEFSESLQIDISRLKINDEQMDG 162 AIYTSRLL F+NLPEPKNS DYY Q+DNIIS EFSESLQIDIS+L IN+ +G Sbjct: 447 AIYTSRLLNFNNLPEPKNSDDYYKQTDNIISREFSESLQIDISQLNINNINENG 500 >gb|POG67169.1| hypothetical protein GLOIN_2v1650137, partial [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 168 Score = 77.8 bits (190), Expect = 5e-15 Identities = 39/50 (78%), Positives = 46/50 (92%), Gaps = 1/50 (2%) Frame = +1 Query: 1 AIYTSRLLVFDNLPEPKNSYDYY-DQSDNIISNEFSESLQIDISRLKIND 147 A+YTSRLL F+NLPEPKNS DYY +Q+DNIIS +FSESLQIDIS+LKIN+ Sbjct: 118 AVYTSRLLNFNNLPEPKNSDDYYNEQNDNIISEKFSESLQIDISQLKINE 167 >dbj|GBC11175.1| serine/threonine protein kinase [Rhizophagus irregularis DAOM 181602] Length = 1118 Score = 81.6 bits (200), Expect = 5e-15 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +1 Query: 1 AIYTSRLLVFDNLPEPKNSYDYYDQSDNIISNEFSESLQIDISRLKIN 144 AIYTSRLL F+NLPEPKNS DYY+Q+DNIIS EFSESLQIDIS+L IN Sbjct: 1071 AIYTSRLLDFNNLPEPKNSDDYYEQNDNIISKEFSESLQIDISQLNIN 1118 >gb|POG65200.1| kinase-like domain-containing protein [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 618 Score = 81.3 bits (199), Expect = 7e-15 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = +1 Query: 1 AIYTSRLLVFDNLPEPKNSYDYYDQSDNIISNEFSESLQIDISRLKI 141 AIYTSRLL F+NLPEPKNSYDYY+Q+D+IIS EFSESLQIDIS+L I Sbjct: 566 AIYTSRLLNFNNLPEPKNSYDYYEQNDDIISKEFSESLQIDISQLNI 612 >gb|PKC67989.1| kinase-like protein [Rhizophagus irregularis] Length = 986 Score = 81.3 bits (199), Expect = 7e-15 Identities = 39/51 (76%), Positives = 45/51 (88%) Frame = +1 Query: 1 AIYTSRLLVFDNLPEPKNSYDYYDQSDNIISNEFSESLQIDISRLKINDEQ 153 AIYTSRLL F+NLPEPKNS DYY+Q DNIIS EFSESLQI+IS+L IN+ + Sbjct: 891 AIYTSRLLSFNNLPEPKNSVDYYEQIDNIISKEFSESLQINISQLNINENE 941 >dbj|GBC40463.1| serine/threonine protein kinase [Rhizophagus irregularis DAOM 181602] Length = 1029 Score = 81.3 bits (199), Expect = 7e-15 Identities = 39/51 (76%), Positives = 45/51 (88%) Frame = +1 Query: 1 AIYTSRLLVFDNLPEPKNSYDYYDQSDNIISNEFSESLQIDISRLKINDEQ 153 AIYTSRLL F+NLPEPKNS DYY+Q DNIIS EFSESLQI+IS+L IN+ + Sbjct: 962 AIYTSRLLSFNNLPEPKNSVDYYEQIDNIISKEFSESLQINISQLNINENE 1012 >gb|PKC00435.1| hypothetical protein RhiirA5_428193 [Rhizophagus irregularis] Length = 1630 Score = 81.3 bits (199), Expect = 7e-15 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = +1 Query: 1 AIYTSRLLVFDNLPEPKNSYDYYDQSDNIISNEFSESLQIDISRLKI 141 AIYTSRLL F+NLPEPKNSYDYY+Q+D+IIS EFSESLQIDIS+L I Sbjct: 1578 AIYTSRLLNFNNLPEPKNSYDYYEQNDDIISKEFSESLQIDISQLNI 1624 >dbj|GBC52497.1| serine/threonine protein kinase [Rhizophagus irregularis DAOM 181602] Length = 1632 Score = 81.3 bits (199), Expect = 7e-15 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = +1 Query: 1 AIYTSRLLVFDNLPEPKNSYDYYDQSDNIISNEFSESLQIDISRLKI 141 AIYTSRLL F+NLPEPKNSYDYY+Q+D+IIS EFSESLQIDIS+L I Sbjct: 1580 AIYTSRLLNFNNLPEPKNSYDYYEQNDDIISKEFSESLQIDISQLNI 1626 >dbj|GBC31037.1| serine/threonine protein kinase [Rhizophagus irregularis DAOM 181602] Length = 812 Score = 80.9 bits (198), Expect = 9e-15 Identities = 40/54 (74%), Positives = 46/54 (85%) Frame = +1 Query: 1 AIYTSRLLVFDNLPEPKNSYDYYDQSDNIISNEFSESLQIDISRLKINDEQMDG 162 AIYTSR+L F+NLPEPKNS DYY Q+DNIIS EFSESLQIDIS+L IN+ +G Sbjct: 756 AIYTSRILNFNNLPEPKNSDDYYKQTDNIISGEFSESLQIDISQLNINNINENG 809