BLASTX nr result
ID: Ophiopogon26_contig00052098
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00052098 (387 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC16326.1| Tis13_345859 [Rhizophagus irregularis DAOM 181602] 61 2e-11 >dbj|GBC16326.1| Tis13_345859 [Rhizophagus irregularis DAOM 181602] Length = 59 Score = 60.8 bits (146), Expect(2) = 2e-11 Identities = 28/32 (87%), Positives = 30/32 (93%), Gaps = 1/32 (3%) Frame = -2 Query: 179 KFLRLDLLKYNSSNEEGWFW-LEKEDAIHFIL 87 KFLRLDLLKYNSSNEEGWFW LEKE+A+H IL Sbjct: 10 KFLRLDLLKYNSSNEEGWFWLLEKEEAVHLIL 41 Score = 35.8 bits (81), Expect(2) = 2e-11 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 94 LYFFRNKLCRVRSLSVRHVTM 32 L RNKLCRVRSLS RHVTM Sbjct: 39 LILVRNKLCRVRSLSDRHVTM 59