BLASTX nr result
ID: Ophiopogon26_contig00050997
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00050997 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY57026.1| hypothetical protein RhiirA4_508866 [Rhizophagus ... 66 3e-10 gb|PKY19036.1| hypothetical protein RhiirB3_431982 [Rhizophagus ... 64 8e-10 gb|PKB94217.1| hypothetical protein RhiirA5_439294, partial [Rhi... 62 1e-08 gb|POG55033.1| hypothetical protein GLOIN_2v1792052 [Rhizophagus... 62 1e-08 gb|PKC57187.1| hypothetical protein RhiirA1_472888 [Rhizophagus ... 62 1e-08 >gb|PKY57026.1| hypothetical protein RhiirA4_508866 [Rhizophagus irregularis] Length = 248 Score = 65.9 bits (159), Expect = 3e-10 Identities = 32/78 (41%), Positives = 48/78 (61%), Gaps = 2/78 (2%) Frame = +3 Query: 177 KSAKLDVVIELRNY--GIELATAEVGITQKDHDDLKFREDHTALKIELKDMIDNFYDMLH 350 KS D++ + + EL EVG T+ DD K+R+DH+ LK+ +KD +D+ + LH Sbjct: 95 KSIDADLIFKTMEFFHEAELLPLEVGNTEGPIDDTKYRKDHSKLKVVIKDCLDSLWSKLH 154 Query: 351 FKKKDLANIFVIGIQATG 404 FKK +L +F +GIQ TG Sbjct: 155 FKKVELEEVFALGIQITG 172 >gb|PKY19036.1| hypothetical protein RhiirB3_431982 [Rhizophagus irregularis] Length = 364 Score = 63.9 bits (154), Expect(2) = 8e-10 Identities = 41/90 (45%), Positives = 46/90 (51%), Gaps = 1/90 (1%) Frame = +3 Query: 135 KKT*IYTEYVKFGNKSAKLDVVIELRNYGIELATAEVGITQKDHDDLKFREDHTALKIEL 314 K+ I+ EYVK GN+S KLDVVIELRNY Sbjct: 291 KRRKIHAEYVKLGNESTKLDVVIELRNY-------------------------------- 318 Query: 315 KDMIDNFYDMLHFKKK-DLANIFVIGIQAT 401 DNFYD+LHFKKK DLA FV+GIQAT Sbjct: 319 ----DNFYDVLHFKKKKDLAETFVMGIQAT 344 Score = 26.9 bits (58), Expect(2) = 8e-10 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +1 Query: 103 IEKESKAVQTRKRHR 147 IEKESKAV TRKR + Sbjct: 280 IEKESKAVHTRKRRK 294 >gb|PKB94217.1| hypothetical protein RhiirA5_439294, partial [Rhizophagus irregularis] Length = 227 Score = 61.6 bits (148), Expect = 1e-08 Identities = 29/65 (44%), Positives = 42/65 (64%) Frame = +3 Query: 210 RNYGIELATAEVGITQKDHDDLKFREDHTALKIELKDMIDNFYDMLHFKKKDLANIFVIG 389 RN + L ++ VG T+ DD K+R+DH+ LK+ +KD +D+ + LHFKK L F +G Sbjct: 88 RNSILALLSSSVGNTEGPIDDTKYRKDHSKLKVVMKDCLDSLWSKLHFKKVVLEEAFALG 147 Query: 390 IQATG 404 IQ TG Sbjct: 148 IQITG 152 >gb|POG55033.1| hypothetical protein GLOIN_2v1792052 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 274 Score = 62.0 bits (149), Expect = 1e-08 Identities = 30/65 (46%), Positives = 42/65 (64%) Frame = +3 Query: 210 RNYGIELATAEVGITQKDHDDLKFREDHTALKIELKDMIDNFYDMLHFKKKDLANIFVIG 389 RN + L ++ VG T+ DD K+R+DH+ LKI +KD +D+ + LHFKK L F +G Sbjct: 135 RNSILALLSSSVGNTEGPIDDTKYRKDHSKLKIVMKDYLDSLWSKLHFKKVVLEEAFALG 194 Query: 390 IQATG 404 IQ TG Sbjct: 195 IQITG 199 >gb|PKC57187.1| hypothetical protein RhiirA1_472888 [Rhizophagus irregularis] gb|PKY27686.1| hypothetical protein RhiirB3_529348 [Rhizophagus irregularis] Length = 273 Score = 61.6 bits (148), Expect = 1e-08 Identities = 29/65 (44%), Positives = 42/65 (64%) Frame = +3 Query: 210 RNYGIELATAEVGITQKDHDDLKFREDHTALKIELKDMIDNFYDMLHFKKKDLANIFVIG 389 RN + L ++ VG T+ DD K+R+DH+ LK+ +KD +D+ + LHFKK L F +G Sbjct: 134 RNSILALLSSSVGNTEGPIDDTKYRKDHSKLKVVMKDCLDSLWSKLHFKKVVLEEAFALG 193 Query: 390 IQATG 404 IQ TG Sbjct: 194 IQITG 198