BLASTX nr result
ID: Ophiopogon26_contig00050905
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00050905 (943 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC04783.1| hypothetical protein RhiirA5_487068, partial [Rhi... 72 1e-12 >gb|PKC04783.1| hypothetical protein RhiirA5_487068, partial [Rhizophagus irregularis] Length = 67 Score = 72.0 bits (175), Expect = 1e-12 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +1 Query: 835 NSANYCLKLILLFSSSCISTILPI*LSSFCYPEGNF 942 NSANYCLKLIL FSSSC+STILPI LSSFCYPEGNF Sbjct: 2 NSANYCLKLILFFSSSCVSTILPISLSSFCYPEGNF 37