BLASTX nr result
ID: Ophiopogon26_contig00050900
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00050900 (522 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX63857.1| hypothetical protein RirG_148400 [Rhizophagus irr... 55 3e-06 >gb|EXX63857.1| hypothetical protein RirG_148400 [Rhizophagus irregularis DAOM 197198w] Length = 144 Score = 54.7 bits (130), Expect = 3e-06 Identities = 31/70 (44%), Positives = 44/70 (62%), Gaps = 1/70 (1%) Frame = +3 Query: 84 VPIIECPNSDEPYTYTGLSSPNLGPYKPTTDVSAISADGLLKPPSKNEQ-KKRNNSPFGR 260 + +IE E Y YT S+PNL P K +T S SA+ L +P S+N+ + R++SPF R Sbjct: 62 ISVIERHFLAESYPYTSQSNPNLRPLKSSTTTS--SANRLPRPQSRNDHDRSRSSSPFCR 119 Query: 261 DFGKEITDQF 290 + GKE+TD F Sbjct: 120 NVGKEVTDNF 129