BLASTX nr result
ID: Ophiopogon26_contig00050844
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00050844 (451 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC50234.1| hypothetical protein RIR_3199300 [Rhizophagus ir... 65 3e-09 gb|PKY43399.1| hypothetical protein RhiirA4_398713 [Rhizophagus ... 65 3e-09 gb|PKK71261.1| hypothetical protein RhiirC2_744980 [Rhizophagus ... 65 3e-09 gb|PKC10084.1| hypothetical protein RhiirA5_355948 [Rhizophagus ... 65 3e-09 gb|EXX74707.1| hypothetical protein RirG_048590 [Rhizophagus irr... 65 3e-09 >dbj|GBC50234.1| hypothetical protein RIR_3199300 [Rhizophagus irregularis DAOM 181602] Length = 657 Score = 64.7 bits (156), Expect = 3e-09 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 95 LYLFIAVNRNWCRNGIKYLWKNPFRGDVDLK 3 L+ I VNRNWCRNGIKYLWKNPFRGDVDLK Sbjct: 22 LHSIILVNRNWCRNGIKYLWKNPFRGDVDLK 52 >gb|PKY43399.1| hypothetical protein RhiirA4_398713 [Rhizophagus irregularis] Length = 694 Score = 64.7 bits (156), Expect = 3e-09 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 95 LYLFIAVNRNWCRNGIKYLWKNPFRGDVDLK 3 L+ I VNRNWCRNGIKYLWKNPFRGDVDLK Sbjct: 22 LHSIILVNRNWCRNGIKYLWKNPFRGDVDLK 52 >gb|PKK71261.1| hypothetical protein RhiirC2_744980 [Rhizophagus irregularis] Length = 694 Score = 64.7 bits (156), Expect = 3e-09 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 95 LYLFIAVNRNWCRNGIKYLWKNPFRGDVDLK 3 L+ I VNRNWCRNGIKYLWKNPFRGDVDLK Sbjct: 22 LHSIILVNRNWCRNGIKYLWKNPFRGDVDLK 52 >gb|PKC10084.1| hypothetical protein RhiirA5_355948 [Rhizophagus irregularis] Length = 694 Score = 64.7 bits (156), Expect = 3e-09 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 95 LYLFIAVNRNWCRNGIKYLWKNPFRGDVDLK 3 L+ I VNRNWCRNGIKYLWKNPFRGDVDLK Sbjct: 22 LHSIILVNRNWCRNGIKYLWKNPFRGDVDLK 52 >gb|EXX74707.1| hypothetical protein RirG_048590 [Rhizophagus irregularis DAOM 197198w] gb|PKC64681.1| hypothetical protein RhiirA1_421316 [Rhizophagus irregularis] gb|PKY12311.1| hypothetical protein RhiirB3_397239 [Rhizophagus irregularis] gb|POG68215.1| hypothetical protein GLOIN_2v1639021 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 694 Score = 64.7 bits (156), Expect = 3e-09 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 95 LYLFIAVNRNWCRNGIKYLWKNPFRGDVDLK 3 L+ I VNRNWCRNGIKYLWKNPFRGDVDLK Sbjct: 22 LHSIILVNRNWCRNGIKYLWKNPFRGDVDLK 52