BLASTX nr result
ID: Ophiopogon26_contig00050774
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00050774 (414 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX67203.1| hypothetical protein RirG_116530 [Rhizophagus irr... 73 1e-12 gb|PKC12689.1| hypothetical protein RhiirA5_352675 [Rhizophagus ... 73 2e-12 >gb|EXX67203.1| hypothetical protein RirG_116530 [Rhizophagus irregularis DAOM 197198w] dbj|GBC48816.1| bzip transcription factor [Rhizophagus irregularis DAOM 181602] gb|POG75496.1| hypothetical protein GLOIN_2v1565375 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 276 Score = 72.8 bits (177), Expect = 1e-12 Identities = 39/62 (62%), Positives = 40/62 (64%) Frame = +2 Query: 227 MPQELXXXXXXXXXXXXXXXXXXXXXXASKNKLEQKFNKNDDTSKSLKRTAPIDVSSQGD 406 MPQEL ASKNKLEQKFNKNDDTSKSLKRTAP+DVSSQGD Sbjct: 1 MPQELQSTNQQSQTTTVEEVKPTTTVTASKNKLEQKFNKNDDTSKSLKRTAPVDVSSQGD 60 Query: 407 AK 412 AK Sbjct: 61 AK 62 >gb|PKC12689.1| hypothetical protein RhiirA5_352675 [Rhizophagus irregularis] gb|PKC71385.1| hypothetical protein RhiirA1_413318 [Rhizophagus irregularis] gb|PKK68232.1| hypothetical protein RhiirC2_750558 [Rhizophagus irregularis] gb|PKY20466.1| hypothetical protein RhiirB3_408298 [Rhizophagus irregularis] gb|PKY37638.1| hypothetical protein RhiirA4_390746 [Rhizophagus irregularis] Length = 307 Score = 72.8 bits (177), Expect = 2e-12 Identities = 39/62 (62%), Positives = 40/62 (64%) Frame = +2 Query: 227 MPQELXXXXXXXXXXXXXXXXXXXXXXASKNKLEQKFNKNDDTSKSLKRTAPIDVSSQGD 406 MPQEL ASKNKLEQKFNKNDDTSKSLKRTAP+DVSSQGD Sbjct: 1 MPQELQSTNQQSQTTTVEEVKPTTTVTASKNKLEQKFNKNDDTSKSLKRTAPVDVSSQGD 60 Query: 407 AK 412 AK Sbjct: 61 AK 62