BLASTX nr result
ID: Ophiopogon26_contig00050736
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00050736 (536 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC49571.1| hypothetical protein RIR_3144300 [Rhizophagus ir... 71 2e-11 gb|EXX55720.1| hypothetical protein RirG_222830 [Rhizophagus irr... 60 2e-07 >dbj|GBC49571.1| hypothetical protein RIR_3144300 [Rhizophagus irregularis DAOM 181602] Length = 308 Score = 71.2 bits (173), Expect = 2e-11 Identities = 39/59 (66%), Positives = 42/59 (71%), Gaps = 12/59 (20%) Frame = -3 Query: 261 RISLNEKATKS------------DETSDVLVLSKRDNLRRLRSDFEIGDNTQGDGGLGK 121 RISLNEKATKS DE SD+LVL KRDNL RLRSDFEIG+NT+ DGGL K Sbjct: 69 RISLNEKATKSTKRIIDQINIVQDEASDILVLCKRDNLMRLRSDFEIGENTEEDGGLAK 127 >gb|EXX55720.1| hypothetical protein RirG_222830 [Rhizophagus irregularis DAOM 197198w] dbj|GBC25775.1| hypothetical protein: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 443 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = +2 Query: 2 PNLNNTTLLPYPYFNQTYPIPHQFSPN 82 PNLNNTTLLPYP+FNQT+P+PHQFSPN Sbjct: 313 PNLNNTTLLPYPHFNQTHPMPHQFSPN 339