BLASTX nr result
ID: Ophiopogon26_contig00050726
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00050726 (475 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC29661.1| Tis13_28691: PROVISIONAL [Rhizophagus irregulari... 66 1e-11 gb|EXX66920.1| hypothetical protein RirG_119160 [Rhizophagus irr... 65 2e-10 dbj|GBC24637.1| CENP-b protein 1 [Rhizophagus irregularis DAOM 1... 59 2e-09 gb|PKC04996.1| hypothetical protein RhiirA5_378963 [Rhizophagus ... 59 2e-09 gb|EXX65838.1| hypothetical protein RirG_129500 [Rhizophagus irr... 59 2e-09 dbj|GBC42162.1| CENP-b protein 1 [Rhizophagus irregularis DAOM 1... 65 3e-09 dbj|GBC28751.1| CENP-b protein 1 [Rhizophagus irregularis DAOM 1... 64 3e-09 dbj|GBC27779.1| tigger transposable element-derived protein 6-li... 61 5e-09 gb|EXX65524.1| hypothetical protein RirG_132370 [Rhizophagus irr... 61 7e-09 gb|PKK76055.1| hypothetical protein RhiirC2_772920 [Rhizophagus ... 59 7e-09 gb|PKC06857.1| hypothetical protein RhiirA5_418988 [Rhizophagus ... 59 8e-09 gb|PKC71233.1| hypothetical protein RhiirA1_532128 [Rhizophagus ... 60 1e-08 gb|EXX54004.1| hypothetical protein RirG_238650 [Rhizophagus irr... 60 2e-08 gb|PKK68320.1| CenpB-DNA-bind-domain-containing protein [Rhizoph... 61 2e-08 dbj|GBC27778.1| CENP-b protein 1 [Rhizophagus irregularis DAOM 1... 61 2e-08 dbj|GBC27777.1| CENP-b protein 1 [Rhizophagus irregularis DAOM 1... 61 3e-08 dbj|GBC21164.1| CENP-b protein 1 [Rhizophagus irregularis DAOM 1... 59 3e-07 dbj|GBC50342.1| CENP-b protein 1 [Rhizophagus irregularis DAOM 1... 59 3e-07 dbj|GBC36345.1| CENP-b protein 1 [Rhizophagus irregularis DAOM 1... 57 2e-06 >dbj|GBC29661.1| Tis13_28691: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 57 Score = 66.2 bits (160), Expect = 1e-11 Identities = 32/39 (82%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = +3 Query: 315 TWKDHQKWLEVLSTSHTARTFWQRSVQFPELDIA-MQIW 428 TWKDHQKWL VLSTS TARTF QR VQFPELD+A MQ W Sbjct: 13 TWKDHQKWLAVLSTSQTARTFRQRFVQFPELDMATMQTW 51 >gb|EXX66920.1| hypothetical protein RirG_119160 [Rhizophagus irregularis DAOM 197198w] dbj|GBC21042.1| tigger transposable element-derived protein 6-like [Rhizophagus irregularis DAOM 181602] Length = 120 Score = 64.7 bits (156), Expect = 2e-10 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = +3 Query: 312 KTWKDHQKWLEVLSTSHTARTFWQRSVQFPELDIAMQIWT 431 K WK H+KWL VLSTS T+ F RSVQFPELD AMQIWT Sbjct: 56 KIWKSHEKWLSVLSTSQTSHIFRHRSVQFPELDKAMQIWT 95 >dbj|GBC24637.1| CENP-b protein 1 [Rhizophagus irregularis DAOM 181602] Length = 347 Score = 59.3 bits (142), Expect(2) = 2e-09 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +3 Query: 312 KTWKDHQKWLEVLSTSHTARTFWQRSVQFPELDIAMQIWT 431 K WKD +KWL VLS S TA TF Q+ VQ+P+LD AMQ+WT Sbjct: 59 KIWKDRKKWLAVLSNSQTAHTFRQQPVQYPKLDKAMQMWT 98 Score = 30.0 bits (66), Expect(2) = 2e-09 Identities = 12/15 (80%), Positives = 15/15 (100%) Frame = +2 Query: 431 LASGVPLTDGMLQQK 475 +ASG+PLTDG+LQQK Sbjct: 102 VASGIPLTDGILQQK 116 >gb|PKC04996.1| hypothetical protein RhiirA5_378963 [Rhizophagus irregularis] Length = 225 Score = 59.3 bits (142), Expect(2) = 2e-09 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +3 Query: 312 KTWKDHQKWLEVLSTSHTARTFWQRSVQFPELDIAMQIWT 431 K WKD +KWL VLS S TA TF Q+ VQ+P+LD AMQ+WT Sbjct: 59 KIWKDQKKWLAVLSNSQTAHTFRQQPVQYPKLDKAMQMWT 98 Score = 30.0 bits (66), Expect(2) = 2e-09 Identities = 12/15 (80%), Positives = 15/15 (100%) Frame = +2 Query: 431 LASGVPLTDGMLQQK 475 +ASG+PLTDG+LQQK Sbjct: 102 VASGIPLTDGILQQK 116 >gb|EXX65838.1| hypothetical protein RirG_129500 [Rhizophagus irregularis DAOM 197198w] Length = 199 Score = 59.3 bits (142), Expect(2) = 2e-09 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +3 Query: 312 KTWKDHQKWLEVLSTSHTARTFWQRSVQFPELDIAMQIWT 431 K WKD +KWL VLS S TA TF Q+ VQ+P+LD AMQ+WT Sbjct: 59 KIWKDRKKWLAVLSNSQTAHTFRQQPVQYPKLDKAMQMWT 98 Score = 30.0 bits (66), Expect(2) = 2e-09 Identities = 12/15 (80%), Positives = 15/15 (100%) Frame = +2 Query: 431 LASGVPLTDGMLQQK 475 +ASG+PLTDG+LQQK Sbjct: 102 VASGIPLTDGILQQK 116 >dbj|GBC42162.1| CENP-b protein 1 [Rhizophagus irregularis DAOM 181602] Length = 469 Score = 65.1 bits (157), Expect = 3e-09 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = +3 Query: 312 KTWKDHQKWLEVLSTSHTARTFWQRSVQFPELDIAMQIWT 431 K WKD QKWL VLSTS + TF QRSVQFPE+D AMQIWT Sbjct: 32 KIWKDKQKWLSVLSTSQFSHTFRQRSVQFPEVDKAMQIWT 71 >dbj|GBC28751.1| CENP-b protein 1 [Rhizophagus irregularis DAOM 181602] Length = 224 Score = 63.5 bits (153), Expect = 3e-09 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +3 Query: 312 KTWKDHQKWLEVLSTSHTARTFWQRSVQFPELDIAMQIWT 431 K WK+ QKWL VLSTS + TF QRSVQFPE+D AMQIWT Sbjct: 32 KIWKNKQKWLSVLSTSQFSHTFHQRSVQFPEVDKAMQIWT 71 >dbj|GBC27779.1| tigger transposable element-derived protein 6-like [Rhizophagus irregularis DAOM 181602] Length = 133 Score = 61.2 bits (147), Expect = 5e-09 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +3 Query: 312 KTWKDHQKWLEVLSTSHTARTFWQRSVQFPELDIAMQIWT 431 K WK+ +KWL VLSTS T F RSVQFPELD AMQIWT Sbjct: 59 KIWKEREKWLAVLSTSQTPHIFRHRSVQFPELDKAMQIWT 98 >gb|EXX65524.1| hypothetical protein RirG_132370 [Rhizophagus irregularis DAOM 197198w] Length = 144 Score = 61.2 bits (147), Expect = 7e-09 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +3 Query: 312 KTWKDHQKWLEVLSTSHTARTFWQRSVQFPELDIAMQIWT 431 K WK+ +KWL VLSTS T F RSVQFPELD AMQIWT Sbjct: 59 KIWKEREKWLAVLSTSQTPHIFRHRSVQFPELDKAMQIWT 98 >gb|PKK76055.1| hypothetical protein RhiirC2_772920 [Rhizophagus irregularis] Length = 58 Score = 58.9 bits (141), Expect = 7e-09 Identities = 30/37 (81%), Positives = 30/37 (81%), Gaps = 2/37 (5%) Frame = +3 Query: 324 DHQKWLEVLSTSHTARTFWQRSVQFPELDIA--MQIW 428 DHQKWL VLSTS TARTF QR VQFPELDIA MQ W Sbjct: 16 DHQKWLAVLSTSQTARTFRQRFVQFPELDIAATMQTW 52 >gb|PKC06857.1| hypothetical protein RhiirA5_418988 [Rhizophagus irregularis] Length = 79 Score = 59.3 bits (142), Expect = 8e-09 Identities = 30/36 (83%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = +3 Query: 324 DHQKWLEVLSTSHTARTFWQRSVQFPELDIA-MQIW 428 DHQKWL VLSTS TARTF QR VQFPELDIA MQ W Sbjct: 16 DHQKWLAVLSTSQTARTFRQRFVQFPELDIATMQTW 51 >gb|PKC71233.1| hypothetical protein RhiirA1_532128 [Rhizophagus irregularis] Length = 113 Score = 60.1 bits (144), Expect = 1e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 342 EVLSTSHTARTFWQRSVQFPELDIAMQIWT 431 E LSTS TARTFWQRSVQFPELD+AMQIWT Sbjct: 84 EALSTSQTARTFWQRSVQFPELDMAMQIWT 113 >gb|EXX54004.1| hypothetical protein RirG_238650 [Rhizophagus irregularis DAOM 197198w] Length = 141 Score = 60.1 bits (144), Expect = 2e-08 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +3 Query: 312 KTWKDHQKWLEVLSTSHTARTFWQRSVQFPELDIAMQIWT 431 K WKD QKWL VL TS + TF QRSVQF E+D AMQIWT Sbjct: 58 KIWKDKQKWLSVLFTSQFSHTFCQRSVQFSEVDKAMQIWT 97 >gb|PKK68320.1| CenpB-DNA-bind-domain-containing protein [Rhizophagus irregularis] Length = 181 Score = 60.8 bits (146), Expect = 2e-08 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +3 Query: 312 KTWKDHQKWLEVLSTSHTARTFWQRSVQFPELDIAMQIWT 431 K WK+ +KWL VLSTS T F RSVQFPELD AMQIWT Sbjct: 59 KIWKEREKWLVVLSTSQTPHIFRHRSVQFPELDKAMQIWT 98 >dbj|GBC27778.1| CENP-b protein 1 [Rhizophagus irregularis DAOM 181602] Length = 207 Score = 61.2 bits (147), Expect = 2e-08 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +3 Query: 312 KTWKDHQKWLEVLSTSHTARTFWQRSVQFPELDIAMQIWT 431 K WK+ +KWL VLSTS T F RSVQFPELD AMQIWT Sbjct: 59 KIWKEREKWLAVLSTSQTPHIFRHRSVQFPELDKAMQIWT 98 >dbj|GBC27777.1| CENP-b protein 1 [Rhizophagus irregularis DAOM 181602] Length = 455 Score = 61.2 bits (147), Expect(2) = 3e-08 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +3 Query: 312 KTWKDHQKWLEVLSTSHTARTFWQRSVQFPELDIAMQIWT 431 K WK+ +KWL VLSTS T F RSVQFPELD AMQIWT Sbjct: 59 KIWKEREKWLAVLSTSQTPHIFRHRSVQFPELDKAMQIWT 98 Score = 24.3 bits (51), Expect(2) = 3e-08 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = +2 Query: 434 ASGVPLTDGMLQQK 475 A+G+PLTD +LQQK Sbjct: 103 AAGLPLTDMILQQK 116 >dbj|GBC21164.1| CENP-b protein 1 [Rhizophagus irregularis DAOM 181602] Length = 559 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +3 Query: 312 KTWKDHQKWLEVLSTSHTARTFWQRSVQFPELDIAMQIWT 431 K W++ +KW+ VLSTS TA TF RSVQ+PELD A+QIWT Sbjct: 59 KIWQNREKWMAVLSTSQTACTFRHRSVQYPELDKALQIWT 98 >dbj|GBC50342.1| CENP-b protein 1 [Rhizophagus irregularis DAOM 181602] dbj|GBC49586.1| CENP-b protein 1 [Rhizophagus irregularis DAOM 181602] dbj|GBC39361.1| CENP-b protein 1 [Rhizophagus irregularis DAOM 181602] dbj|GBC34331.1| CENP-b protein 1 [Rhizophagus irregularis DAOM 181602] dbj|GBC16379.1| CENP-b protein 1 [Rhizophagus irregularis DAOM 181602] dbj|GBC13711.1| CENP-b protein 1 [Rhizophagus irregularis DAOM 181602] Length = 559 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +3 Query: 312 KTWKDHQKWLEVLSTSHTARTFWQRSVQFPELDIAMQIWT 431 K W++ +KW+ VLSTS TA TF RSVQ+PELD A+QIWT Sbjct: 59 KIWQNREKWMAVLSTSQTACTFRHRSVQYPELDKALQIWT 98 >dbj|GBC36345.1| CENP-b protein 1 [Rhizophagus irregularis DAOM 181602] Length = 404 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = +3 Query: 312 KTWKDHQKWLEVLSTSHTARTFWQRSVQFPELDIAMQIWT 431 K W++ +KW+ VLSTS TA TF SVQ+PELD A+QIWT Sbjct: 59 KIWQNREKWMAVLSTSQTACTFHHCSVQYPELDKALQIWT 98