BLASTX nr result
ID: Ophiopogon26_contig00050684
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00050684 (491 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY59244.1| hypothetical protein RhiirA4_514744 [Rhizophagus ... 65 3e-09 gb|PKY61274.1| hypothetical protein RhiirA4_412909 [Rhizophagus ... 62 4e-08 >gb|PKY59244.1| hypothetical protein RhiirA4_514744 [Rhizophagus irregularis] Length = 583 Score = 65.1 bits (157), Expect = 3e-09 Identities = 43/88 (48%), Positives = 51/88 (57%) Frame = -3 Query: 447 KFIKMGEVQKVMDFISLNIKRKPMLLAFQMR*RDKSSTNPKNR**SDRIRA*KSLKSCTK 268 K K GE F L I KPM L+FQM+ R++ ST P D++ + KS + Sbjct: 441 KICKNGEGADEDGFCFLIINGKPMFLSFQMKWREQYSTKPSKI--DDQLIKEEYEKS-EE 497 Query: 267 DWFG*IVDKDNFNDFYGKIYSSRAQFAA 184 DWFG DNFNDFYGKIYSSRAQF A Sbjct: 498 DWFG-----DNFNDFYGKIYSSRAQFFA 520 >gb|PKY61274.1| hypothetical protein RhiirA4_412909 [Rhizophagus irregularis] Length = 743 Score = 62.0 bits (149), Expect = 4e-08 Identities = 46/95 (48%), Positives = 54/95 (56%), Gaps = 7/95 (7%) Frame = -3 Query: 447 KFIKMGEVQKVMDFISLNIKRKPMLLAFQMR*RDKSSTNPKNR**SDRI---RA*KSLKS 277 K K GE F L I KPM L+FQM+ R++ ST P D++ KS + Sbjct: 588 KICKNGEGADEDGFCFLIINGKPMFLSFQMKWREQYSTKPSKI--DDQLIKEEYEKSEED 645 Query: 276 CT--KDWFG*--IVDKDNFNDFYGKIYSSRAQFAA 184 CT KD IVD+DNFNDFYGKIYSSRAQF A Sbjct: 646 CTYTKDLPPNCAIVDRDNFNDFYGKIYSSRAQFFA 680