BLASTX nr result
ID: Ophiopogon26_contig00050640
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00050640 (877 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC40161.1| Tis13_94769, partial [Rhizophagus irregularis DA... 64 7e-14 >dbj|GBC40161.1| Tis13_94769, partial [Rhizophagus irregularis DAOM 181602] Length = 133 Score = 63.9 bits (154), Expect(2) = 7e-14 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 727 NLSLAFHTGVRHDRLYKTLDYTLNELYMIS 638 NLSLAFHTGVRHDRLYKTLDYTLNELYMI+ Sbjct: 28 NLSLAFHTGVRHDRLYKTLDYTLNELYMIN 57 Score = 42.4 bits (98), Expect(2) = 7e-14 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -2 Query: 786 KKLVQEAIREVCRKNIHAGVTF 721 KKLVQE IREVCRKNIH GV F Sbjct: 1 KKLVQEGIREVCRKNIHTGVLF 22 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 311 ILDLRYLSLYQRAFYMLDILTDAMRIFLIKIVEKGI 204 +++LR+LSLY+RAFYMLDIL DAMRIFLIKIVEK + Sbjct: 55 MINLRHLSLYRRAFYMLDILIDAMRIFLIKIVEKDL 90