BLASTX nr result
ID: Ophiopogon26_contig00050616
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00050616 (1260 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC16498.1| hypothetical protein RIR_0463000 [Rhizophagus ir... 105 2e-24 >dbj|GBC16498.1| hypothetical protein RIR_0463000 [Rhizophagus irregularis DAOM 181602] Length = 82 Score = 105 bits (263), Expect = 2e-24 Identities = 53/64 (82%), Positives = 53/64 (82%) Frame = +1 Query: 157 MAKKIFVHKAHINLVYTSTHFVHRNLSDKPGPVILHNYQPRCLKGLLMSRINGKIGTNAQ 336 MAKKIFVHKAH NLVYTSTHFVHR L DK GPVILHNYQPRCLK L INGKIGTN Q Sbjct: 1 MAKKIFVHKAHKNLVYTSTHFVHRILFDKLGPVILHNYQPRCLKEQL---INGKIGTNVQ 57 Query: 337 SWNF 348 SW F Sbjct: 58 SWKF 61