BLASTX nr result
ID: Ophiopogon26_contig00050554
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00050554 (514 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY52715.1| hypothetical protein RhiirA4_425483 [Rhizophagus ... 79 2e-15 >gb|PKY52715.1| hypothetical protein RhiirA4_425483 [Rhizophagus irregularis] Length = 147 Score = 78.6 bits (192), Expect = 2e-15 Identities = 34/63 (53%), Positives = 45/63 (71%) Frame = +1 Query: 1 VQASIYRHTNGCQLWHACAIVTLIRRLHWAAGNYQGNPHIKDIRIAIQQNNAMVMTQYVR 180 +Q S+YRH GC L H CA + I WA GN+QG+PH+++IRIAIQ + AMVMT +V+ Sbjct: 51 IQQSVYRHAAGCILAHTCAAIVHISGFAWAPGNFQGSPHVREIRIAIQVSPAMVMTTFVQ 110 Query: 181 GGP 189 G P Sbjct: 111 GDP 113