BLASTX nr result
ID: Ophiopogon26_contig00050510
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00050510 (831 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POG60652.1| hypothetical protein GLOIN_2v1711253 [Rhizophagus... 92 2e-20 >gb|POG60652.1| hypothetical protein GLOIN_2v1711253 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 59 Score = 92.0 bits (227), Expect = 2e-20 Identities = 45/55 (81%), Positives = 46/55 (83%) Frame = +2 Query: 203 MLFRMFRWLILNLADPPFLVFSQEYVDSHFYSYTVSGSLSIKIKKRNKGSKAVSF 367 MLFRMFRWLILNLADPPFLVFSQEYVDSHFY YTVSGSLSIK KK K + F Sbjct: 1 MLFRMFRWLILNLADPPFLVFSQEYVDSHFYGYTVSGSLSIKRKKEIKDLRLFPF 55