BLASTX nr result
ID: Ophiopogon26_contig00050457
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00050457 (499 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX74001.1| Cdc15p [Rhizophagus irregularis DAOM 197198w] >gi... 52 5e-06 >gb|EXX74001.1| Cdc15p [Rhizophagus irregularis DAOM 197198w] dbj|GBC41299.1| serine/threonine protein kinase [Rhizophagus irregularis DAOM 181602] Length = 1247 Score = 52.4 bits (124), Expect(2) = 5e-06 Identities = 26/59 (44%), Positives = 34/59 (57%) Frame = -3 Query: 356 KEIFKKNLLVVGHTGDGKSILCNLFTDTDEIKEVSVQLVD*IFFQKKKIFRMEKVLNIV 180 K+ KN++++GHTG GKS LCN+ TD+DE E FQKK M K N+V Sbjct: 986 KKRINKNVIIIGHTGGGKSTLCNVLTDSDEFDESGNSFSVTNSFQKKNFQWMGKCFNVV 1044 Score = 25.4 bits (54), Expect(2) = 5e-06 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -1 Query: 463 VSDCSKLDQLDCSRNKL 413 +S+CSKL LDCS + L Sbjct: 935 ISNCSKLKFLDCSNSNL 951