BLASTX nr result
ID: Ophiopogon26_contig00050455
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00050455 (1176 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY59286.1| hypothetical protein RhiirA4_412372 [Rhizophagus ... 45 6e-07 gb|PKC56320.1| hypothetical protein RhiirA1_429190 [Rhizophagus ... 45 6e-07 gb|EXX61843.1| hypothetical protein RirG_167370 [Rhizophagus irr... 45 6e-07 >gb|PKY59286.1| hypothetical protein RhiirA4_412372 [Rhizophagus irregularis] Length = 183 Score = 44.7 bits (104), Expect(2) = 6e-07 Identities = 20/33 (60%), Positives = 25/33 (75%), Gaps = 3/33 (9%) Frame = +1 Query: 670 KNNKENGFRAQFQEWLNK---QYVNRGPKSLAY 759 + KE GFRAQFQEWL+K ++VN+ PKSL Y Sbjct: 65 RTTKEKGFRAQFQEWLDKAPQEFVNKDPKSLVY 97 Score = 38.9 bits (89), Expect(2) = 6e-07 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +3 Query: 498 LYDDTYSVPETCKARGFDPIK 560 +Y DTY PE CKARGFDPIK Sbjct: 27 MYGDTYLDPEKCKARGFDPIK 47 >gb|PKC56320.1| hypothetical protein RhiirA1_429190 [Rhizophagus irregularis] gb|PKY34148.1| hypothetical protein RhiirB3_420780 [Rhizophagus irregularis] Length = 183 Score = 44.7 bits (104), Expect(2) = 6e-07 Identities = 20/33 (60%), Positives = 25/33 (75%), Gaps = 3/33 (9%) Frame = +1 Query: 670 KNNKENGFRAQFQEWLNK---QYVNRGPKSLAY 759 + KE GFRAQFQEWL+K ++VN+ PKSL Y Sbjct: 65 RTTKEKGFRAQFQEWLDKAPQEFVNKDPKSLVY 97 Score = 38.9 bits (89), Expect(2) = 6e-07 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +3 Query: 498 LYDDTYSVPETCKARGFDPIK 560 +Y DTY PE CKARGFDPIK Sbjct: 27 MYGDTYLDPEKCKARGFDPIK 47 >gb|EXX61843.1| hypothetical protein RirG_167370 [Rhizophagus irregularis DAOM 197198w] dbj|GBC32321.1| hypothetical protein RIR_1746400 [Rhizophagus irregularis DAOM 181602] gb|PKC00343.1| hypothetical protein RhiirA5_365793 [Rhizophagus irregularis] gb|POG69436.1| hypothetical protein GLOIN_2v1626641 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 183 Score = 44.7 bits (104), Expect(2) = 6e-07 Identities = 20/33 (60%), Positives = 25/33 (75%), Gaps = 3/33 (9%) Frame = +1 Query: 670 KNNKENGFRAQFQEWLNK---QYVNRGPKSLAY 759 + KE GFRAQFQEWL+K ++VN+ PKSL Y Sbjct: 65 RTTKEKGFRAQFQEWLDKAPQEFVNKDPKSLVY 97 Score = 38.9 bits (89), Expect(2) = 6e-07 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +3 Query: 498 LYDDTYSVPETCKARGFDPIK 560 +Y DTY PE CKARGFDPIK Sbjct: 27 MYGDTYLDPEKCKARGFDPIK 47