BLASTX nr result
ID: Ophiopogon26_contig00050429
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00050429 (552 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC41912.1| hypothetical protein RIR_2521500 [Rhizophagus ir... 58 3e-08 >dbj|GBC41912.1| hypothetical protein RIR_2521500 [Rhizophagus irregularis DAOM 181602] Length = 69 Score = 58.2 bits (139), Expect = 3e-08 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = +1 Query: 79 KFINLIQRLPISCYLRDLNPYTVYKQARCPNVGLLNS 189 KFINLI +SCYLRDLN Y VYKQARC NVGLLNS Sbjct: 33 KFINLIHNA-VSCYLRDLNLYRVYKQARCQNVGLLNS 68