BLASTX nr result
ID: Ophiopogon26_contig00050350
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00050350 (457 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC35419.1| hypothetical protein RIR_1999100 [Rhizophagus ir... 58 2e-07 >dbj|GBC35419.1| hypothetical protein RIR_1999100 [Rhizophagus irregularis DAOM 181602] Length = 183 Score = 58.2 bits (139), Expect = 2e-07 Identities = 30/61 (49%), Positives = 37/61 (60%) Frame = -1 Query: 235 IEFKRCEKAGYIAYLIQEAISQII*KTNSNFSTKTKYAIGCVCSTETRKFVELEFKNSLT 56 + RCEKAGYIAYLIQEAI+Q+ K F + + + KFVELEFKNS + Sbjct: 15 LRISRCEKAGYIAYLIQEAINQLFKKQIQIFLPRLNMLLDVFVRQKLEKFVELEFKNSSS 74 Query: 55 D 53 D Sbjct: 75 D 75