BLASTX nr result
ID: Ophiopogon26_contig00050300
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00050300 (410 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC17914.1| L30e-like protein [Rhizophagus irregularis] >gi|1... 87 7e-19 gb|EXX68323.1| Nhp2p [Rhizophagus irregularis DAOM 197198w] >gi|... 87 2e-18 >gb|PKC17914.1| L30e-like protein [Rhizophagus irregularis] gb|PKC74078.1| L30e-like protein [Rhizophagus irregularis] gb|PKK80383.1| L30e-like protein [Rhizophagus irregularis] gb|PKY12376.1| L30e-like protein [Rhizophagus irregularis] gb|PKY38592.1| L30e-like protein [Rhizophagus irregularis] gb|POG80306.1| 50S ribosomal protein L30e-like protein [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 168 Score = 87.0 bits (214), Expect = 7e-19 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = -3 Query: 408 KRPTSVVMIVPDRKNEDNNLEYKESFEKCLNEVKELEQFMIH 283 KRPTSVVMIVPDRKNEDNNLEYKES EKCLNEVKELEQFMIH Sbjct: 127 KRPTSVVMIVPDRKNEDNNLEYKESLEKCLNEVKELEQFMIH 168 >gb|EXX68323.1| Nhp2p [Rhizophagus irregularis DAOM 197198w] dbj|GBC26118.1| H/ACA ribonucleoprotein complex subunit 2 [Rhizophagus irregularis DAOM 181602] Length = 206 Score = 87.0 bits (214), Expect = 2e-18 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = -3 Query: 408 KRPTSVVMIVPDRKNEDNNLEYKESFEKCLNEVKELEQFMIH 283 KRPTSVVMIVPDRKNEDNNLEYKES EKCLNEVKELEQFMIH Sbjct: 165 KRPTSVVMIVPDRKNEDNNLEYKESLEKCLNEVKELEQFMIH 206