BLASTX nr result
ID: Ophiopogon26_contig00050272
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00050272 (1405 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC25329.1| hypothetical protein RIR_1180200 [Rhizophagus ir... 102 4e-23 gb|PKC74601.1| hypothetical protein RhiirA1_181901 [Rhizophagus ... 100 2e-22 >dbj|GBC25329.1| hypothetical protein RIR_1180200 [Rhizophagus irregularis DAOM 181602] Length = 77 Score = 102 bits (255), Expect = 4e-23 Identities = 58/74 (78%), Positives = 58/74 (78%), Gaps = 1/74 (1%) Frame = +1 Query: 946 FD*NHPNLKKFRNSVLMFVSLANIKV*FITFIKRNVFYYMHWIVEVYLVDIIMSL-TNVP 1122 F NHPNLK L VSLANIKV FI FIKRNV YYMH IVEVYLVDIIMSL NVP Sbjct: 4 FSKNHPNLKNLEILCLCLVSLANIKVLFIIFIKRNVVYYMHRIVEVYLVDIIMSLIPNVP 63 Query: 1123 IQLKKLLSIIYLRT 1164 IQLKKLLSIIYLRT Sbjct: 64 IQLKKLLSIIYLRT 77 >gb|PKC74601.1| hypothetical protein RhiirA1_181901 [Rhizophagus irregularis] Length = 79 Score = 100 bits (250), Expect = 2e-22 Identities = 57/73 (78%), Positives = 57/73 (78%), Gaps = 1/73 (1%) Frame = +1 Query: 946 FD*NHPNLKKFRNSVLMFVSLANIKV*FITFIKRNVFYYMHWIVEVYLVDIIMSL-TNVP 1122 F NHPNLK L VSLANIKV FI FIKRNV YYMH IVEVYLVDIIMSL NVP Sbjct: 7 FSKNHPNLKNLEILCLCLVSLANIKVLFIIFIKRNVVYYMHRIVEVYLVDIIMSLIPNVP 66 Query: 1123 IQLKKLLSIIYLR 1161 IQLKKLLSIIYLR Sbjct: 67 IQLKKLLSIIYLR 79