BLASTX nr result
ID: Ophiopogon26_contig00050116
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00050116 (438 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC49273.1| hypothetical protein RIR_3119100 [Rhizophagus ir... 168 1e-51 >dbj|GBC49273.1| hypothetical protein RIR_3119100 [Rhizophagus irregularis DAOM 181602] gb|PKB94685.1| hypothetical protein RhiirA5_368165 [Rhizophagus irregularis] gb|PKC53236.1| hypothetical protein RhiirA1_430132 [Rhizophagus irregularis] gb|PKK66243.1| hypothetical protein RhiirC2_753757 [Rhizophagus irregularis] gb|PKY29627.1| hypothetical protein RhiirB3_418145 [Rhizophagus irregularis] gb|POG75545.1| hypothetical protein GLOIN_2v1872703 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 104 Score = 168 bits (426), Expect = 1e-51 Identities = 87/104 (83%), Positives = 89/104 (85%), Gaps = 4/104 (3%) Frame = +2 Query: 104 MPSASNNNIPTGSPKTMREFEVLVVXXXXXXXXXGQYHQPQP---MLRTKRINCNQTNGT 274 MPSASNNNIPT PKTMRE+EVLV+ GQYHQPQP MLRTKRINCNQTNGT Sbjct: 1 MPSASNNNIPTSLPKTMREYEVLVIPSSPTSPT-GQYHQPQPQQPMLRTKRINCNQTNGT 59 Query: 275 IFWIPDGYRPVLVRTSDLPLLVGAEYNLPSPSNS-GYTSSDDSN 403 IFWIPDGYRPVLVRTSDLPLLVGAEYNLPSPSNS GYTSSDDSN Sbjct: 60 IFWIPDGYRPVLVRTSDLPLLVGAEYNLPSPSNSTGYTSSDDSN 103