BLASTX nr result
ID: Ophiopogon26_contig00050011
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00050011 (531 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC29926.1| hypothetical protein RIR_1555600 [Rhizophagus ir... 74 7e-14 >dbj|GBC29926.1| hypothetical protein RIR_1555600 [Rhizophagus irregularis DAOM 181602] Length = 125 Score = 74.3 bits (181), Expect = 7e-14 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = +2 Query: 233 EVATTGRKESFSVQGTTDLINPSPAKSPIKVHEDHNRLWSGLF 361 + ATTGRKESFSVQ TTDLINPSP KSPIKVHE HNRL GLF Sbjct: 39 QFATTGRKESFSVQETTDLINPSPTKSPIKVHEGHNRLRPGLF 81