BLASTX nr result
ID: Ophiopogon26_contig00049918
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00049918 (522 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC16283.1| Tis13_19381 [Rhizophagus irregularis DAOM 181602] 71 1e-13 >dbj|GBC16283.1| Tis13_19381 [Rhizophagus irregularis DAOM 181602] Length = 49 Score = 71.2 bits (173), Expect = 1e-13 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -1 Query: 471 FNPMNRQIVTIEYLSIQPSER*SWRLRRIKPTKLLN 364 FNPMNRQIVTIEYLSI+PSER SWRLRRIKPTKLLN Sbjct: 14 FNPMNRQIVTIEYLSIRPSERWSWRLRRIKPTKLLN 49