BLASTX nr result
ID: Ophiopogon26_contig00049871
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00049871 (642 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020255239.1| probable ascorbate-specific transmembrane el... 70 5e-11 emb|CDP22077.1| unnamed protein product, partial [Coffea canephora] 55 9e-07 >ref|XP_020255239.1| probable ascorbate-specific transmembrane electron transporter 2 [Asparagus officinalis] Length = 223 Score = 70.1 bits (170), Expect = 5e-11 Identities = 36/53 (67%), Positives = 42/53 (79%) Frame = +1 Query: 64 ILGLISAVTGLVEKFIYSGLLHGSQALVVNFTGVTIFRFRIATILTVIHTLAY 222 ++ +ISA TGLV+K YS L+HGSQAL+VNFTGV IF F IATILTVI AY Sbjct: 171 LMAIISAETGLVQKSFYSDLIHGSQALLVNFTGVAIFLFGIATILTVILPRAY 223 >emb|CDP22077.1| unnamed protein product, partial [Coffea canephora] Length = 61 Score = 54.7 bits (130), Expect = 9e-07 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = +1 Query: 76 ISAVTGLVEKFIYSGLLHGSQALVVNFTGVTIFRFRIATILTVIHTLAY 222 +SAVTGL+EKFI++GL G QAL+VNFTG+ I F ++ TV+ +Y Sbjct: 13 LSAVTGLIEKFIFTGLRRGQQALMVNFTGLLILLFGVSVGFTVLLPRSY 61