BLASTX nr result
ID: Ophiopogon26_contig00049836
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00049836 (436 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC55029.1| hypothetical protein RhiirA1_504691 [Rhizophagus ... 112 1e-27 dbj|GBC48095.1| hypothetical protein: PROVISIONAL [Rhizophagus i... 79 3e-16 gb|PKK60649.1| hypothetical protein RhiirC2_242844 [Rhizophagus ... 53 8e-13 >gb|PKC55029.1| hypothetical protein RhiirA1_504691 [Rhizophagus irregularis] Length = 266 Score = 112 bits (280), Expect = 1e-27 Identities = 59/73 (80%), Positives = 65/73 (89%), Gaps = 1/73 (1%) Frame = -2 Query: 435 LKPVLLSIDQDVSLSGNSALRKRYCNVLKRIISEKRDIQQVRVATSLLQKDETHGIKEFW 256 LKPV +S DQDVSLS NSALRKRY NVLKRI+SEKRD +QV+VATSLLQKDETHGIKEFW Sbjct: 175 LKPVFMSTDQDVSLSENSALRKRYRNVLKRIVSEKRDNEQVKVATSLLQKDETHGIKEFW 234 Query: 255 ESI-ISIKVARER 220 E+I + KVARER Sbjct: 235 ENINLDKKVARER 247 >dbj|GBC48095.1| hypothetical protein: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 124 Score = 79.3 bits (194), Expect = 3e-16 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = -2 Query: 435 LKPVLLSIDQDVSLSGNSALRKRYCNVLKRIISEKRDIQQVRVATSLLQK 286 LKPV +S DQDVSLS NSALRKRY NVLKRI+SEKRD +QV+VATSLLQK Sbjct: 24 LKPVFMSTDQDVSLSENSALRKRYRNVLKRIVSEKRDNEQVKVATSLLQK 73 >gb|PKK60649.1| hypothetical protein RhiirC2_242844 [Rhizophagus irregularis] Length = 261 Score = 52.8 bits (125), Expect(3) = 8e-13 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -1 Query: 160 ITFNKESRLDALKVLGSTLANEANVATDEFKIE 62 ITF KESRLDALKVLGS ANEA+ ATDEF IE Sbjct: 59 ITFKKESRLDALKVLGSARANEADGATDEFNIE 91 Score = 40.4 bits (93), Expect(3) = 8e-13 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 1/27 (3%) Frame = -2 Query: 288 KDETHGIKEFWESI-ISIKVARERMCF 211 +DETHGIKEFWE+I + KVARER+ F Sbjct: 35 EDETHGIKEFWENINLDKKVARERITF 61 Score = 27.3 bits (59), Expect(3) = 8e-13 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -3 Query: 320 SKLELRLHYYRR 285 SKL+LRLHYYRR Sbjct: 2 SKLKLRLHYYRR 13