BLASTX nr result
ID: Ophiopogon26_contig00049739
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00049739 (562 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY32869.1| hypothetical protein RhiirB3_420313, partial [Rhi... 66 6e-11 gb|PKY34354.1| hypothetical protein RhiirB3_420831, partial [Rhi... 61 3e-09 gb|EXX51656.1| hypothetical protein RirG_260040 [Rhizophagus irr... 66 3e-09 gb|PKY33167.1| hypothetical protein RhiirB3_532364 [Rhizophagus ... 61 8e-09 gb|PKY34829.1| hypothetical protein RhiirB3_454931 [Rhizophagus ... 60 9e-09 gb|POG53564.1| hypothetical protein GLOIN_2v1740292, partial [Rh... 60 9e-09 gb|POG65505.1| BTB/POZ protein [Rhizophagus irregularis DAOM 181... 60 2e-08 gb|EXX54210.1| hypothetical protein RirG_236720 [Rhizophagus irr... 63 3e-08 gb|PKY18032.1| POZ domain-containing protein [Rhizophagus irregu... 59 4e-08 gb|POG62156.1| hypothetical protein GLOIN_2v644064 [Rhizophagus ... 58 5e-08 gb|PKY26534.1| hypothetical protein RhiirB3_415247, partial [Rhi... 57 6e-08 gb|PKC09874.1| hypothetical protein RhiirA5_356175, partial [Rhi... 57 6e-08 gb|EXX56804.1| hypothetical protein RirG_212850 [Rhizophagus irr... 58 6e-08 gb|POG73335.1| hypothetical protein GLOIN_2v1586889, partial [Rh... 57 8e-08 gb|PKY31741.1| hypothetical protein RhiirB3_419716, partial [Rhi... 57 8e-08 gb|POG81474.1| hypothetical protein GLOIN_2v1508234, partial [Rh... 57 9e-08 gb|PKY17348.1| hypothetical protein RhiirB3_404200, partial [Rhi... 57 1e-07 gb|EXX54223.1| hypothetical protein RirG_236430 [Rhizophagus irr... 57 1e-07 gb|EXX53779.1| hypothetical protein RirG_240730 [Rhizophagus irr... 61 1e-07 gb|PKY33913.1| hypothetical protein RhiirB3_532653 [Rhizophagus ... 57 1e-07 >gb|PKY32869.1| hypothetical protein RhiirB3_420313, partial [Rhizophagus irregularis] gb|POG61722.1| hypothetical protein GLOIN_2v1701973, partial [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 85 Score = 65.9 bits (159), Expect = 6e-11 Identities = 36/54 (66%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = -3 Query: 227 DNEYDDINIGISNDSYVKIFHAY-VDIFYRSPYLRRILSTNRKNYKNG*IFTRI 69 DNEY D I + ND YVKIFHA+ V ++YRSPYLRRILSTNRK KN I T I Sbjct: 20 DNEYYDTTIEVGNDPYVKIFHAHMVILYYRSPYLRRILSTNRK--KNDGILTHI 71 >gb|PKY34354.1| hypothetical protein RhiirB3_420831, partial [Rhizophagus irregularis] Length = 63 Score = 60.8 bits (146), Expect = 3e-09 Identities = 30/43 (69%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = -3 Query: 227 DNEYDDINIGISNDSYVKIFHAYVDIF-YRSPYLRRILSTNRK 102 D EY DI I + ND YVKIFHA+++I YRSPYLRRILSTN+K Sbjct: 20 DEEYYDIIIEVGNDPYVKIFHAHMNILNYRSPYLRRILSTNKK 62 >gb|EXX51656.1| hypothetical protein RirG_260040 [Rhizophagus irregularis DAOM 197198w] dbj|GBC18020.1| serine-enriched protein [Rhizophagus irregularis DAOM 181602] Length = 488 Score = 65.9 bits (159), Expect = 3e-09 Identities = 36/54 (66%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = -3 Query: 227 DNEYDDINIGISNDSYVKIFHAY-VDIFYRSPYLRRILSTNRKNYKNG*IFTRI 69 DNEY D I + ND YVKIFHA+ V ++YRSPYLRRILSTNRK KN I T I Sbjct: 20 DNEYYDTTIEVGNDPYVKIFHAHMVILYYRSPYLRRILSTNRK--KNDGILTHI 71 >gb|PKY33167.1| hypothetical protein RhiirB3_532364 [Rhizophagus irregularis] Length = 104 Score = 60.8 bits (146), Expect = 8e-09 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Frame = -3 Query: 227 DNEYDDINIGISNDSYVKIFHAYVDIF-YRSPYLRRILSTNRKNYKNG*IFTRI 69 D+EY DI I + ND YVK+F A++ I YRSPYLRRILSTN+K KN I T I Sbjct: 20 DDEYYDITIEVGNDPYVKVFRAHIAILNYRSPYLRRILSTNKK--KNDGILTHI 71 >gb|PKY34829.1| hypothetical protein RhiirB3_454931 [Rhizophagus irregularis] Length = 95 Score = 60.5 bits (145), Expect = 9e-09 Identities = 33/54 (61%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = -3 Query: 227 DNEYDDINIGISNDSYVKIFHAY-VDIFYRSPYLRRILSTNRKNYKNG*IFTRI 69 D EY DI I + ND Y+KIFHA+ V + YRSPYLRRILSTN K KN I + I Sbjct: 20 DEEYYDITIEVGNDPYIKIFHAHMVILHYRSPYLRRILSTNNKK-KNDDILSHI 72 >gb|POG53564.1| hypothetical protein GLOIN_2v1740292, partial [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 68 Score = 59.7 bits (143), Expect = 9e-09 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = -3 Query: 227 DNEYDDINIGISNDSYVKIFHAYVDIF-YRSPYLRRILSTNRKN 99 D EY DI I + ND YVKIF A++ I YRSPYLRRILSTN+KN Sbjct: 20 DEEYYDITIEVGNDPYVKIFRAHMVILNYRSPYLRRILSTNKKN 63 >gb|POG65505.1| BTB/POZ protein [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 134 Score = 60.5 bits (145), Expect = 2e-08 Identities = 33/54 (61%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = -3 Query: 227 DNEYDDINIGISNDSYVKIFHAY-VDIFYRSPYLRRILSTNRKNYKNG*IFTRI 69 D EY DI I + ND Y+KIFHA+ V + YRSPYLRRILSTN K KN I + I Sbjct: 20 DEEYYDITIEVGNDPYIKIFHAHMVILHYRSPYLRRILSTNNKK-KNDDILSHI 72 >gb|EXX54210.1| hypothetical protein RirG_236720 [Rhizophagus irregularis DAOM 197198w] dbj|GBC12364.1| btb/poz domain-containing protein 19 [Rhizophagus irregularis DAOM 181602] Length = 472 Score = 63.2 bits (152), Expect = 3e-08 Identities = 34/54 (62%), Positives = 37/54 (68%), Gaps = 1/54 (1%) Frame = -3 Query: 227 DNEYDDINIGISNDSYVKIFHAYVDIF-YRSPYLRRILSTNRKNYKNG*IFTRI 69 DNEY DI I + ND YVKIF A++ I YRSPYLRRILSTN KN I T I Sbjct: 20 DNEYYDITIEVGNDPYVKIFRAHMVILNYRSPYLRRILSTNSNKNKNDGILTHI 73 >gb|PKY18032.1| POZ domain-containing protein [Rhizophagus irregularis] Length = 121 Score = 59.3 bits (142), Expect = 4e-08 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = -3 Query: 227 DNEYDDINIGISNDSYVKIFHAY-VDIFYRSPYLRRILSTNRK 102 DNE+ D+ I + ND YVKIF A+ V ++YRSPYLRRILSTN+K Sbjct: 20 DNEFYDVTIEVGNDPYVKIFRAHIVVLYYRSPYLRRILSTNKK 62 >gb|POG62156.1| hypothetical protein GLOIN_2v644064 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 85 Score = 58.2 bits (139), Expect = 5e-08 Identities = 29/57 (50%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Frame = -3 Query: 227 DNEYDDINIGISNDSYVKIFHAYVDIF-YRSPYLRRILSTNRKNYKNG*IFTRILHT 60 D+EY DI I + D VKIF A+++I YRSPYLRRIL +N+KN NG + ++ +T Sbjct: 19 DDEYYDITIEVGEDPNVKIFRAHMNILCYRSPYLRRILKSNKKNNDNGLVHIKLSNT 75 >gb|PKY26534.1| hypothetical protein RhiirB3_415247, partial [Rhizophagus irregularis] Length = 64 Score = 57.4 bits (137), Expect = 6e-08 Identities = 29/43 (67%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = -3 Query: 227 DNEYDDINIGISNDSYVKIFHAYVDIF-YRSPYLRRILSTNRK 102 D EY DI I + ND YVKIF A++ I YRSPYLRRILSTN+K Sbjct: 20 DEEYYDITIEVGNDPYVKIFRAHMVILNYRSPYLRRILSTNKK 62 >gb|PKC09874.1| hypothetical protein RhiirA5_356175, partial [Rhizophagus irregularis] Length = 64 Score = 57.4 bits (137), Expect = 6e-08 Identities = 29/43 (67%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = -3 Query: 227 DNEYDDINIGISNDSYVKIFHAYVDIF-YRSPYLRRILSTNRK 102 D EY DI I + ND YVKIF A++ I YRSPYLRRILSTN+K Sbjct: 20 DEEYYDITIEVGNDPYVKIFRAHMVILNYRSPYLRRILSTNKK 62 >gb|EXX56804.1| hypothetical protein RirG_212850 [Rhizophagus irregularis DAOM 197198w] dbj|GBC26797.1| JEMT01027519.1_cds_EXX56804.1_23226 [Rhizophagus irregularis DAOM 181602] Length = 93 Score = 58.2 bits (139), Expect = 6e-08 Identities = 28/43 (65%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = -3 Query: 227 DNEYDDINIGISNDSYVKIFHAYVDIF-YRSPYLRRILSTNRK 102 D+EY DI I + +D+YVKIF A+++I YRSPYLRRILSTN+K Sbjct: 21 DDEYYDITIEVGSDTYVKIFRAHMNILNYRSPYLRRILSTNKK 63 >gb|POG73335.1| hypothetical protein GLOIN_2v1586889, partial [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 74 Score = 57.4 bits (137), Expect = 8e-08 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = -3 Query: 227 DNEYDDINIGISNDSYVKIFHAY-VDIFYRSPYLRRILSTNRK 102 D+EY DI I + ND YV IF A+ V ++YRSPYLRRILSTN+K Sbjct: 8 DDEYYDITIEVGNDPYVNIFRAHKVILYYRSPYLRRILSTNKK 50 >gb|PKY31741.1| hypothetical protein RhiirB3_419716, partial [Rhizophagus irregularis] Length = 64 Score = 57.0 bits (136), Expect = 8e-08 Identities = 29/43 (67%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = -3 Query: 227 DNEYDDINIGISNDSYVKIFHAYVDIF-YRSPYLRRILSTNRK 102 D EY DI I + ND VKIFHA++ I YRSPYLRRILSTN+K Sbjct: 20 DEEYYDITIEVGNDPNVKIFHAHMVILNYRSPYLRRILSTNKK 62 >gb|POG81474.1| hypothetical protein GLOIN_2v1508234, partial [Rhizophagus irregularis DAOM 181602=DAOM 197198] gb|POG81475.1| hypothetical protein GLOIN_2v1508241, partial [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 68 Score = 57.0 bits (136), Expect = 9e-08 Identities = 28/43 (65%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = -3 Query: 227 DNEYDDINIGISNDSYVKIFHAYVDIF-YRSPYLRRILSTNRK 102 D EY DI I + ND YVK+F A++ I YRSPYLRRILSTN+K Sbjct: 20 DEEYYDITIEVGNDPYVKVFRAHMVILNYRSPYLRRILSTNKK 62 >gb|PKY17348.1| hypothetical protein RhiirB3_404200, partial [Rhizophagus irregularis] gb|PKY25275.1| hypothetical protein RhiirB3_413921, partial [Rhizophagus irregularis] Length = 84 Score = 57.4 bits (137), Expect = 1e-07 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = -3 Query: 227 DNEYDDINIGISNDSYVKIFHAYVDIF-YRSPYLRRILSTNRKNYKNG*IFTRI 69 D+EY D+ I + ND YVK+F A++ I YRSPYLRRILSTN+K KN T I Sbjct: 19 DDEYYDVTIEVGNDPYVKVFRAHMVILNYRSPYLRRILSTNKK--KNDGTLTHI 70 >gb|EXX54223.1| hypothetical protein RirG_236430 [Rhizophagus irregularis DAOM 197198w] Length = 91 Score = 57.4 bits (137), Expect = 1e-07 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = -3 Query: 227 DNEYDDINIGISNDSYVKIFHAY-VDIFYRSPYLRRILSTNRK 102 D+EY DI I + ND YV IF A+ V ++YRSPYLRRILSTN+K Sbjct: 20 DDEYYDITIEVGNDPYVNIFRAHKVILYYRSPYLRRILSTNKK 62 >gb|EXX53779.1| hypothetical protein RirG_240730 [Rhizophagus irregularis DAOM 197198w] dbj|GBC27228.1| kelch-like protein 17 [Rhizophagus irregularis DAOM 181602] Length = 466 Score = 61.2 bits (147), Expect = 1e-07 Identities = 34/54 (62%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Frame = -3 Query: 227 DNEYDDINIGISNDSYVKIFHAYVDIF-YRSPYLRRILSTNRKNYKNG*IFTRI 69 D EY DI I + ND YVKIFHA+++I YRSPYLRRILSTN+K KN T I Sbjct: 20 DEEYYDIIIEVGNDPYVKIFHAHMNILNYRSPYLRRILSTNKK--KNDGTLTNI 71 >gb|PKY33913.1| hypothetical protein RhiirB3_532653 [Rhizophagus irregularis] Length = 94 Score = 57.4 bits (137), Expect = 1e-07 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = -3 Query: 227 DNEYDDINIGISNDSYVKIFHAYVDIF-YRSPYLRRILSTNRK 102 D+EY DI I + ND YVK+F A++ I YRSPYLRRILSTN+K Sbjct: 17 DDEYYDITIEVGNDPYVKVFRAHMVILNYRSPYLRRILSTNKK 59