BLASTX nr result
ID: Ophiopogon26_contig00049715
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00049715 (403 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX76135.1| Sts1p [Rhizophagus irregularis DAOM 197198w] >gi|... 90 9e-19 ref|XP_021875066.1| Cut8 six-helix bundle-domain-containing prot... 54 9e-06 >gb|EXX76135.1| Sts1p [Rhizophagus irregularis DAOM 197198w] dbj|GBC46344.1| Tethering factor for nuclear proteasome Cut8 [Rhizophagus irregularis DAOM 181602] gb|PKC10350.1| Cut8-domain-containing protein [Rhizophagus irregularis] gb|PKC71861.1| Cut8-domain-containing protein [Rhizophagus irregularis] gb|PKK75555.1| Cut8-domain-containing protein [Rhizophagus irregularis] gb|PKY15678.1| Cut8-domain-containing protein [Rhizophagus irregularis] gb|PKY39073.1| Cut8-domain-containing protein [Rhizophagus irregularis] gb|POG72029.1| hypothetical protein GLOIN_2v1599523 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 336 Score = 90.1 bits (222), Expect = 9e-19 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = +1 Query: 1 VVSEWARNLAQHNRESNGLFQHAINEFIDKLGWIAGIQVGSNP 129 VVSEWARNLAQHNRESNG+FQH+INEFIDKLGWIAGIQVG+NP Sbjct: 268 VVSEWARNLAQHNRESNGMFQHSINEFIDKLGWIAGIQVGTNP 310 >ref|XP_021875066.1| Cut8 six-helix bundle-domain-containing protein, partial [Lobosporangium transversale] gb|ORY89577.1| Cut8 six-helix bundle-domain-containing protein, partial [Lobosporangium transversale] Length = 228 Score = 53.5 bits (127), Expect = 9e-06 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = +1 Query: 4 VSEWARNLAQHNRESNGLFQHAINEFIDKLGWIAGIQ 114 V EWA+NL QHN S G+F AI EF KLGWI GIQ Sbjct: 159 VQEWAKNLEQHNITSQGMFSSAIEEFKSKLGWIIGIQ 195