BLASTX nr result
ID: Ophiopogon26_contig00049614
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00049614 (803 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY37667.1| hypothetical protein RhiirA4_390763 [Rhizophagus ... 63 2e-09 >gb|PKY37667.1| hypothetical protein RhiirA4_390763 [Rhizophagus irregularis] Length = 83 Score = 63.2 bits (152), Expect = 2e-09 Identities = 34/59 (57%), Positives = 38/59 (64%) Frame = +1 Query: 286 IIRFSK**QKRNRFINGSRSNN*FRIKAYANKIKEEFEILNHMLDSNITDLSLALTYFW 462 +IR +K F+N R +ANKIK EFEILNHMLDSNITDLS ALTYFW Sbjct: 19 LIRLPDTLRKIKTFVNEVTQLKVLRKYLHANKIKGEFEILNHMLDSNITDLSFALTYFW 77