BLASTX nr result
ID: Ophiopogon26_contig00049610
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00049610 (540 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY51405.1| hypothetical protein RhiirA4_468421 [Rhizophagus ... 63 8e-11 >gb|PKY51405.1| hypothetical protein RhiirA4_468421 [Rhizophagus irregularis] Length = 107 Score = 62.8 bits (151), Expect(2) = 8e-11 Identities = 39/73 (53%), Positives = 45/73 (61%), Gaps = 1/73 (1%) Frame = -3 Query: 472 YLMKGGSPEAKNYATLLDKNFKGHRLNDMDSKLFWDRIESQLAFDAE-IEMKGREMRLAE 296 YLMK GSPEAKNYATLLDKN + Q+ F AE + + R + LAE Sbjct: 50 YLMKDGSPEAKNYATLLDKNSR------------------QVMFVAEGFKQRFRVLSLAE 91 Query: 295 AGTATGIMKRING 257 AGTATGIMKRI+G Sbjct: 92 AGTATGIMKRIDG 104 Score = 31.6 bits (70), Expect(2) = 8e-11 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 522 EEKDFTSSFQKETFIL 475 +EKDF SSFQKETFIL Sbjct: 29 KEKDFPSSFQKETFIL 44