BLASTX nr result
ID: Ophiopogon26_contig00049458
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00049458 (513 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK78011.1| hypothetical protein RhiirC2_730829 [Rhizophagus ... 44 4e-06 gb|POG74621.1| hypothetical protein GLOIN_2v1575696, partial [Rh... 44 4e-06 >gb|PKK78011.1| hypothetical protein RhiirC2_730829 [Rhizophagus irregularis] Length = 59 Score = 43.9 bits (102), Expect(2) = 4e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 220 MEEQQSLDREDVLSLITR*VVKANYLTYLTF 312 MEEQQSLDREDVLSLIT +YLTYLTF Sbjct: 1 MEEQQSLDREDVLSLIT------SYLTYLTF 25 Score = 34.7 bits (78), Expect(2) = 4e-06 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +2 Query: 320 EG*KDIFGIFVAEKVEIFFTLEIKINSLDGF 412 +G K GI VAEKVEIFF LEI+I GF Sbjct: 27 KGLKGYLGILVAEKVEIFFILEIEIIVWIGF 57 >gb|POG74621.1| hypothetical protein GLOIN_2v1575696, partial [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 60 Score = 43.9 bits (102), Expect(2) = 4e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 220 MEEQQSLDREDVLSLITR*VVKANYLTYLTF 312 MEEQQSLDREDVLSLIT +YLTYLTF Sbjct: 1 MEEQQSLDREDVLSLIT------SYLTYLTF 25 Score = 34.7 bits (78), Expect(2) = 4e-06 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +2 Query: 320 EG*KDIFGIFVAEKVEIFFTLEIKINSLDGF 412 +G K GI VAEKVEIFF LEI+I GF Sbjct: 27 KGLKGYLGILVAEKVEIFFILEIEIIVWIGF 57