BLASTX nr result
ID: Ophiopogon26_contig00047626
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00047626 (440 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC55230.1| hypothetical protein RhiirA1_446886 [Rhizophagus ... 100 1e-21 dbj|GBC28713.1| hypothetical protein RIR_1456500 [Rhizophagus ir... 76 2e-15 gb|PKK69405.1| hypothetical protein RhiirC2_712687 [Rhizophagus ... 74 9e-14 >gb|PKC55230.1| hypothetical protein RhiirA1_446886 [Rhizophagus irregularis] Length = 748 Score = 100 bits (248), Expect = 1e-21 Identities = 52/87 (59%), Positives = 56/87 (64%), Gaps = 26/87 (29%) Frame = -3 Query: 183 DTRPDRALARKWDSDRSRNQFHIHQPTFTNGGTNN------------------------D 76 DTRPDRALARKWDSDRS NQFHIHQPTFTNGGTNN D Sbjct: 247 DTRPDRALARKWDSDRSHNQFHIHQPTFTNGGTNNVNISGLVEGGTFNAGSNSMSQNKVD 306 Query: 75 NYGQKKINEFFSFS--RDENNNSDYED 1 NYGQKKI+E+FSFS R N +DYE+ Sbjct: 307 NYGQKKIDEYFSFSRHRKRQNENDYEE 333 >dbj|GBC28713.1| hypothetical protein RIR_1456500 [Rhizophagus irregularis DAOM 181602] Length = 74 Score = 75.9 bits (185), Expect = 2e-15 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 183 DTRPDRALARKWDSDRSRNQFHIHQPTFTNGGTNN 79 DTRPDRALARKWDS+RSRNQFHIHQPTFTN GTNN Sbjct: 28 DTRPDRALARKWDSNRSRNQFHIHQPTFTNDGTNN 62 >gb|PKK69405.1| hypothetical protein RhiirC2_712687 [Rhizophagus irregularis] Length = 156 Score = 73.9 bits (180), Expect = 9e-14 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -3 Query: 213 IGHF*IFCC*DTRPDRALARKWDSDRSRNQFHIHQPTFTNGGTNN 79 I F ++ C DTRP RALA KWDS+RSRNQFHIHQPTFTN GTNN Sbjct: 17 IHRFDMYRCTDTRPVRALASKWDSNRSRNQFHIHQPTFTNDGTNN 61