BLASTX nr result
ID: Ophiopogon26_contig00047558
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00047558 (399 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY30829.1| hypothetical protein RhiirB3_419090 [Rhizophagus ... 124 2e-34 dbj|GBC14319.1| Type 1 serine/threonine-protein phosphatase cata... 128 5e-33 gb|PKC01552.1| hypothetical protein RhiirA5_364857 [Rhizophagus ... 66 7e-12 gb|ORY05516.1| Metallo-dependent phosphatase [Basidiobolus meris... 55 3e-06 gb|EXX53993.1| Glc7p [Rhizophagus irregularis DAOM 197198w] >gi|... 55 3e-06 gb|PKC01460.1| Metallo-dependent phosphatase [Rhizophagus irregu... 55 3e-06 >gb|PKY30829.1| hypothetical protein RhiirB3_419090 [Rhizophagus irregularis] gb|PKY55568.1| hypothetical protein RhiirA4_410621 [Rhizophagus irregularis] Length = 87 Score = 124 bits (310), Expect = 2e-34 Identities = 61/79 (77%), Positives = 64/79 (81%) Frame = -2 Query: 398 KILFWVISTIEFILAHKNSPIQLSLSTFFAYSSNSGQANQPIRRLPIPHKNAFSLPDHFA 219 KILFWVISTIEFILAHK +Q S ++ QANQP RRLPIPHKNAFSLPDHFA Sbjct: 11 KILFWVISTIEFILAHKT--VQSSSHFLLFLLTHPTQANQPTRRLPIPHKNAFSLPDHFA 68 Query: 218 PCLATYFASNYLCRCVKTP 162 PCLATYFASNYLCRCVKTP Sbjct: 69 PCLATYFASNYLCRCVKTP 87 >dbj|GBC14319.1| Type 1 serine/threonine-protein phosphatase catalytic subunit [Rhizophagus irregularis DAOM 181602] Length = 386 Score = 128 bits (322), Expect = 5e-33 Identities = 66/95 (69%), Positives = 66/95 (69%) Frame = -2 Query: 287 ANQPIRRLPIPHKNAFSLPDHFAPCLATYFASNYLCRCVKTP*TQTPSLFKLFIALAKF* 108 ANQP RRLPIPHKNAFSLPDHFAPCLATYFASNYLCRCVKTP Sbjct: 16 ANQPTRRLPIPHKNAFSLPDHFAPCLATYFASNYLCRCVKTP------------------ 57 Query: 107 IRAERNMGDSTEIDIDSVIDRLLEVRGCRPGKQVQ 3 D EIDIDSVIDRLLEVRGCRPGKQVQ Sbjct: 58 --------DPAEIDIDSVIDRLLEVRGCRPGKQVQ 84 >gb|PKC01552.1| hypothetical protein RhiirA5_364857 [Rhizophagus irregularis] Length = 54 Score = 65.9 bits (159), Expect = 7e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 198 KIGSETGSEMVGQRECVFVWDRKTTNRLVGLA 293 KIGSETGSEMVGQRECVFVWDRKTT+RLVGL+ Sbjct: 16 KIGSETGSEMVGQRECVFVWDRKTTSRLVGLS 47 >gb|ORY05516.1| Metallo-dependent phosphatase [Basidiobolus meristosporus CBS 931.73] Length = 330 Score = 55.5 bits (132), Expect = 3e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -2 Query: 89 MGDSTEIDIDSVIDRLLEVRGCRPGKQVQ 3 M D+T++DIDS+IDRLLEVRGCRPGKQVQ Sbjct: 1 MTDNTDVDIDSIIDRLLEVRGCRPGKQVQ 29 >gb|EXX53993.1| Glc7p [Rhizophagus irregularis DAOM 197198w] gb|EXX53994.1| Glc7p [Rhizophagus irregularis DAOM 197198w] gb|EXX53995.1| Glc7p [Rhizophagus irregularis DAOM 197198w] Length = 331 Score = 55.5 bits (132), Expect = 3e-06 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -2 Query: 89 MGDSTEIDIDSVIDRLLEVRGCRPGKQVQ 3 M D EIDIDSVIDRLLEVRGCRPGKQVQ Sbjct: 1 MSDPAEIDIDSVIDRLLEVRGCRPGKQVQ 29 >gb|PKC01460.1| Metallo-dependent phosphatase [Rhizophagus irregularis] gb|PKC01551.1| Metallo-dependent phosphatase [Rhizophagus irregularis] gb|PKC57406.1| Metallo-dependent phosphatase [Rhizophagus irregularis] gb|PKK61644.1| Metallo-dependent phosphatase [Rhizophagus irregularis] gb|PKY30830.1| Metallo-dependent phosphatase [Rhizophagus irregularis] gb|PKY55569.1| Metallo-dependent phosphatase [Rhizophagus irregularis] gb|POG74317.1| Metallo-dependent phosphatase-like protein [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 331 Score = 55.5 bits (132), Expect = 3e-06 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -2 Query: 89 MGDSTEIDIDSVIDRLLEVRGCRPGKQVQ 3 M D EIDIDSVIDRLLEVRGCRPGKQVQ Sbjct: 1 MSDPAEIDIDSVIDRLLEVRGCRPGKQVQ 29