BLASTX nr result
ID: Ophiopogon26_contig00047542
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00047542 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK79840.1| hypothetical protein RhiirC2_842256 [Rhizophagus ... 103 9e-23 gb|EXX70668.1| bifunctional glycerol-3-phosphate/glycerone-phosp... 103 9e-23 gb|PKY48069.1| hypothetical protein RhiirA4_524061 [Rhizophagus ... 84 7e-16 >gb|PKK79840.1| hypothetical protein RhiirC2_842256 [Rhizophagus irregularis] Length = 687 Score = 103 bits (256), Expect = 9e-23 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = +1 Query: 55 EHHRVEALTWLSRTAPFSELNRTTKIKSKDSEEDSGYHGDKEDENSLKN 201 EHHRVEALTWLSRT PFSELNRTTKIKSKDSEEDSGYHGDKEDENSLKN Sbjct: 639 EHHRVEALTWLSRTTPFSELNRTTKIKSKDSEEDSGYHGDKEDENSLKN 687 >gb|EXX70668.1| bifunctional glycerol-3-phosphate/glycerone-phosphate O-acyltransferase SCT1 [Rhizophagus irregularis DAOM 197198w] gb|PKC13324.1| hypothetical protein RhiirA5_496211 [Rhizophagus irregularis] gb|PKC73631.1| hypothetical protein RhiirA1_520850 [Rhizophagus irregularis] gb|PKY15637.1| hypothetical protein RhiirB3_477288 [Rhizophagus irregularis] gb|POG74992.1| hypothetical protein GLOIN_2v1569631 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 687 Score = 103 bits (256), Expect = 9e-23 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = +1 Query: 55 EHHRVEALTWLSRTAPFSELNRTTKIKSKDSEEDSGYHGDKEDENSLKN 201 EHHRVEALTWLSRT PFSELNRTTKIKSKDSEEDSGYHGDKEDENSLKN Sbjct: 639 EHHRVEALTWLSRTTPFSELNRTTKIKSKDSEEDSGYHGDKEDENSLKN 687 >gb|PKY48069.1| hypothetical protein RhiirA4_524061 [Rhizophagus irregularis] Length = 683 Score = 83.6 bits (205), Expect = 7e-16 Identities = 43/49 (87%), Positives = 43/49 (87%) Frame = +1 Query: 55 EHHRVEALTWLSRTAPFSELNRTTKIKSKDSEEDSGYHGDKEDENSLKN 201 EHHRVEAL LSRTAPFSEL KIKSKDSEEDSGYHGDKEDENSLKN Sbjct: 639 EHHRVEALRCLSRTAPFSEL----KIKSKDSEEDSGYHGDKEDENSLKN 683