BLASTX nr result
ID: Ophiopogon26_contig00047523
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00047523 (467 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC37641.1| hypothetical protein RIR_2173300 [Rhizophagus ir... 82 2e-17 >dbj|GBC37641.1| hypothetical protein RIR_2173300 [Rhizophagus irregularis DAOM 181602] gb|PKC09019.1| hypothetical protein RhiirA5_416201 [Rhizophagus irregularis] gb|PKC73830.1| hypothetical protein RhiirA1_450733 [Rhizophagus irregularis] gb|PKK69609.1| hypothetical protein RhiirC2_780793 [Rhizophagus irregularis] gb|PKY15953.1| hypothetical protein RhiirB3_428246 [Rhizophagus irregularis] gb|PKY38512.1| hypothetical protein RhiirA4_451511 [Rhizophagus irregularis] gb|POG71195.1| hypothetical protein GLOIN_2v1609392 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 79 Score = 81.6 bits (200), Expect = 2e-17 Identities = 45/77 (58%), Positives = 45/77 (58%), Gaps = 2/77 (2%) Frame = -3 Query: 396 MNFSFMFFIAVLALFANLTLALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXS--ICGRPC 223 MNFSFMFFIAVLALFANLTLAL ICGRPC Sbjct: 1 MNFSFMFFIAVLALFANLTLALPGQNPPIKKPTPTPTPTPTPTPSSTSAPTRTSICGRPC 60 Query: 222 VGRACRYNRTLYRCYRE 172 VGRACRYNRTLYRCYRE Sbjct: 61 VGRACRYNRTLYRCYRE 77