BLASTX nr result
ID: Ophiopogon26_contig00047050
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00047050 (474 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC35731.1| hypothetical protein RIR_2026400 [Rhizophagus ir... 80 1e-14 gb|PKK68413.1| hypothetical protein RhiirC2_750255 [Rhizophagus ... 80 2e-14 gb|EXX51295.1| hypothetical protein RirG_263150 [Rhizophagus irr... 80 2e-14 gb|PKY50030.1| hypothetical protein RhiirA4_406044 [Rhizophagus ... 80 2e-14 >dbj|GBC35731.1| hypothetical protein RIR_2026400 [Rhizophagus irregularis DAOM 181602] Length = 440 Score = 80.1 bits (196), Expect = 1e-14 Identities = 38/69 (55%), Positives = 52/69 (75%), Gaps = 6/69 (8%) Frame = +3 Query: 285 NHSQPEPQLDGRHPEINGDSFILTPYVFS---QDDPPPQYTPNDTYAPS---GEDISIRK 446 N+S+P+ Q D HPEIN +++++TPYVF+ +D PP YTPN+ + + GEDISIRK Sbjct: 332 NNSRPQSQPDELHPEINENTYMITPYVFNPEGNNDEPPPYTPNEAFTGNIAPGEDISIRK 391 Query: 447 VTRDDSFDD 473 +TRDDSFDD Sbjct: 392 ITRDDSFDD 400 >gb|PKK68413.1| hypothetical protein RhiirC2_750255 [Rhizophagus irregularis] Length = 466 Score = 80.1 bits (196), Expect = 2e-14 Identities = 38/69 (55%), Positives = 52/69 (75%), Gaps = 6/69 (8%) Frame = +3 Query: 285 NHSQPEPQLDGRHPEINGDSFILTPYVFS---QDDPPPQYTPNDTYAPS---GEDISIRK 446 N+S+P+ Q D HPEIN +++++TPYVF+ +D PP YTPN+ + + GEDISIRK Sbjct: 358 NNSRPQSQPDELHPEINENTYMITPYVFNPEGNNDEPPPYTPNEAFTGNIAPGEDISIRK 417 Query: 447 VTRDDSFDD 473 +TRDDSFDD Sbjct: 418 ITRDDSFDD 426 >gb|EXX51295.1| hypothetical protein RirG_263150 [Rhizophagus irregularis DAOM 197198w] gb|PKC02993.1| hypothetical protein RhiirA5_452616 [Rhizophagus irregularis] gb|PKC64256.1| hypothetical protein RhiirA1_421785 [Rhizophagus irregularis] gb|PKY28979.1| hypothetical protein RhiirB3_417570 [Rhizophagus irregularis] gb|POG82056.1| hypothetical protein GLOIN_2v1502388 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 466 Score = 80.1 bits (196), Expect = 2e-14 Identities = 38/69 (55%), Positives = 52/69 (75%), Gaps = 6/69 (8%) Frame = +3 Query: 285 NHSQPEPQLDGRHPEINGDSFILTPYVFS---QDDPPPQYTPNDTYAPS---GEDISIRK 446 N+S+P+ Q D HPEIN +++++TPYVF+ +D PP YTPN+ + + GEDISIRK Sbjct: 358 NNSRPQSQPDELHPEINENTYMITPYVFNPEGNNDEPPPYTPNEAFTGNIAPGEDISIRK 417 Query: 447 VTRDDSFDD 473 +TRDDSFDD Sbjct: 418 ITRDDSFDD 426 >gb|PKY50030.1| hypothetical protein RhiirA4_406044 [Rhizophagus irregularis] Length = 467 Score = 80.1 bits (196), Expect = 2e-14 Identities = 38/69 (55%), Positives = 52/69 (75%), Gaps = 6/69 (8%) Frame = +3 Query: 285 NHSQPEPQLDGRHPEINGDSFILTPYVFS---QDDPPPQYTPNDTYAPS---GEDISIRK 446 N+S+P+ Q D HPEIN +++++TPYVF+ +D PP YTPN+ + + GEDISIRK Sbjct: 359 NNSRPQSQPDELHPEINENTYMITPYVFNPEGNNDEPPPYTPNEAFTGNIAPGEDISIRK 418 Query: 447 VTRDDSFDD 473 +TRDDSFDD Sbjct: 419 ITRDDSFDD 427