BLASTX nr result
ID: Ophiopogon26_contig00046921
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00046921 (455 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC43454.1| hypothetical protein RIR_2645900 [Rhizophagus ir... 56 3e-06 gb|PKY40195.1| hypothetical protein RhiirA4_453512 [Rhizophagus ... 56 3e-06 gb|EXX55008.1| hypothetical protein RirG_229240 [Rhizophagus irr... 56 3e-06 >dbj|GBC43454.1| hypothetical protein RIR_2645900 [Rhizophagus irregularis DAOM 181602] Length = 997 Score = 56.2 bits (134), Expect = 3e-06 Identities = 30/60 (50%), Positives = 35/60 (58%) Frame = +3 Query: 6 TNIIGRSYDCCKKVRDPGLIDEEEPSQVDSVNSAKSGRNYLIGNRNAEEIFNKWWEIGSG 185 TNIIGRSYDC + +RD D + D S +YLIG EIFNKWW+IGSG Sbjct: 895 TNIIGRSYDCYRSIRDHYSSDSTD----DDYQGHSSRGSYLIG---VNEIFNKWWDIGSG 947 >gb|PKY40195.1| hypothetical protein RhiirA4_453512 [Rhizophagus irregularis] Length = 1016 Score = 56.2 bits (134), Expect = 3e-06 Identities = 30/60 (50%), Positives = 35/60 (58%) Frame = +3 Query: 6 TNIIGRSYDCCKKVRDPGLIDEEEPSQVDSVNSAKSGRNYLIGNRNAEEIFNKWWEIGSG 185 TNIIGRSYDC + +RD D + D S +YLIG EIFNKWW+IGSG Sbjct: 914 TNIIGRSYDCYRSIRDHYSSDSTD----DDYQGHSSRGSYLIG---VNEIFNKWWDIGSG 966 >gb|EXX55008.1| hypothetical protein RirG_229240 [Rhizophagus irregularis DAOM 197198w] gb|PKC04862.1| hypothetical protein RhiirA5_421663 [Rhizophagus irregularis] gb|PKC64210.1| hypothetical protein RhiirA1_462735 [Rhizophagus irregularis] gb|PKY27832.1| hypothetical protein RhiirB3_443702 [Rhizophagus irregularis] gb|POG81170.1| hypothetical protein GLOIN_2v1511246, partial [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 1016 Score = 56.2 bits (134), Expect = 3e-06 Identities = 30/60 (50%), Positives = 35/60 (58%) Frame = +3 Query: 6 TNIIGRSYDCCKKVRDPGLIDEEEPSQVDSVNSAKSGRNYLIGNRNAEEIFNKWWEIGSG 185 TNIIGRSYDC + +RD D + D S +YLIG EIFNKWW+IGSG Sbjct: 914 TNIIGRSYDCYRSIRDHYSSDSTD----DDYQGHSSRGSYLIG---VNEIFNKWWDIGSG 966