BLASTX nr result
ID: Ophiopogon26_contig00046908
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00046908 (414 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY50836.1| hypothetical protein RhiirA4_272180 [Rhizophagus ... 52 3e-06 >gb|PKY50836.1| hypothetical protein RhiirA4_272180 [Rhizophagus irregularis] Length = 58 Score = 51.6 bits (122), Expect = 3e-06 Identities = 29/58 (50%), Positives = 32/58 (55%) Frame = -3 Query: 181 MDYIVIITXXXXXXXXXXXXXXXXXXXXXXXXSTISYYSLPILFTAPSPFPFASTLVI 8 MD+IVIIT S I+YY LP+LFTAPSPFPFASTLVI Sbjct: 1 MDFIVIITSLFPFSFIPRPFVLSLPLPSLTFSSNIAYYFLPVLFTAPSPFPFASTLVI 58