BLASTX nr result
ID: Ophiopogon26_contig00046861
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00046861 (456 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY14267.1| hypothetical protein RhiirB3_519470 [Rhizophagus ... 45 1e-08 gb|EXX73814.1| hypothetical protein RirG_057000 [Rhizophagus irr... 46 1e-06 >gb|PKY14267.1| hypothetical protein RhiirB3_519470 [Rhizophagus irregularis] Length = 209 Score = 45.4 bits (106), Expect(2) = 1e-08 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -3 Query: 136 MRILPRFFIYANELLNYSILYKK 68 M+ILPRFFIYANELLN SILYKK Sbjct: 1 MKILPRFFIYANELLNNSILYKK 23 Score = 41.2 bits (95), Expect(2) = 1e-08 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 72 KKLLSNMQSIDSLRELNAKLLAE 4 KKLLSNMQSI+SL ELNAKLLAE Sbjct: 22 KKLLSNMQSIESLGELNAKLLAE 44 >gb|EXX73814.1| hypothetical protein RirG_057000 [Rhizophagus irregularis DAOM 197198w] Length = 242 Score = 45.8 bits (107), Expect(2) = 1e-06 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = -1 Query: 126 YLVFLSMLTNF*IIPSYIKKLLSNMQSIDSLRELNAKLLAEI 1 + ++ + L N+ + KKLLSN+QSIDSLRELN+KLLAEI Sbjct: 23 FFIYANRLLNY---STLYKKLLSNIQSIDSLRELNSKLLAEI 61 Score = 34.3 bits (77), Expect(2) = 1e-06 Identities = 21/37 (56%), Positives = 22/37 (59%) Frame = -2 Query: 224 IETPFHFVKQVYVLPNLVIYFLHQ*ISNSDEDITSFF 114 +ET FHFV YVLPN NSDEDITSFF Sbjct: 1 METLFHFV---YVLPNF----------NSDEDITSFF 24