BLASTX nr result
ID: Ophiopogon26_contig00046857
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00046857 (453 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003720090.1| hypothetical protein MGG_03806 [Magnaporthe ... 61 1e-08 ref|XP_018065616.1| hypothetical protein LY89DRAFT_240731 [Phial... 59 1e-07 ref|XP_002158731.1| PREDICTED: uncharacterized protein LOC100205... 57 5e-07 gb|ETO18482.1| hypothetical protein RFI_18784 [Reticulomyxa filosa] 56 2e-06 ref|XP_016266040.1| hypothetical protein PV06_01535 [Exophiala o... 55 3e-06 >ref|XP_003720090.1| hypothetical protein MGG_03806 [Magnaporthe oryzae 70-15] gb|EHA47723.1| hypothetical protein MGG_03806 [Magnaporthe oryzae 70-15] gb|ELQ37772.1| hypothetical protein OOU_Y34scaffold00578g2 [Magnaporthe oryzae Y34] gb|ELQ67857.1| hypothetical protein OOW_P131scaffold00282g2 [Magnaporthe oryzae P131] Length = 161 Score = 60.8 bits (146), Expect = 1e-08 Identities = 21/38 (55%), Positives = 25/38 (65%) Frame = -2 Query: 230 AIKVNSECCRRKPDFGCCGNGRCNIFCCNCDGGCNSKC 117 A+ CC++K CCG G+CNIFCCNCDGGC C Sbjct: 13 AVPAALACCKQKGITSCCGKGKCNIFCCNCDGGCRDNC 50 >ref|XP_018065616.1| hypothetical protein LY89DRAFT_240731 [Phialocephala scopiformis] gb|KUJ11261.1| hypothetical protein LY89DRAFT_240731 [Phialocephala scopiformis] Length = 200 Score = 58.5 bits (140), Expect = 1e-07 Identities = 21/49 (42%), Positives = 31/49 (63%) Frame = -2 Query: 260 VLLFLIISSIAIKVNSECCRRKPDFGCCGNGRCNIFCCNCDGGCNSKCE 114 ++ L +S++ + CC K CCG G+CNIFCCNC+GGC+ C+ Sbjct: 5 IIALLTLSTVTLA----CCGNKGVTSCCGKGKCNIFCCNCNGGCDKSCK 49 >ref|XP_002158731.1| PREDICTED: uncharacterized protein LOC100205944 [Hydra vulgaris] Length = 175 Score = 56.6 bits (135), Expect = 5e-07 Identities = 29/57 (50%), Positives = 38/57 (66%), Gaps = 6/57 (10%) Frame = -2 Query: 260 VLLFLIISSIAIK-VNSECCRRK--PDFGCCGNGRCNIFCCNCDG---GCNSKCEKT 108 V + ++I S+ I V+SECC+ +F CCG+GRCNIFCCNC+ GC S C KT Sbjct: 8 VFVLVLIGSLMINSVDSECCKHACCGNFRCCGSGRCNIFCCNCNNDSRGCLS-CTKT 63 >gb|ETO18482.1| hypothetical protein RFI_18784 [Reticulomyxa filosa] Length = 212 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/65 (38%), Positives = 32/65 (49%), Gaps = 13/65 (20%) Frame = -2 Query: 275 MKYVHVLLFLIISSIAIKVNSECCRRKPDF-------------GCCGNGRCNIFCCNCDG 135 M+ + + + I S +V+ ECC+ P GCCG G CNIFCCNCD Sbjct: 1 MQTYYWISIIFILSCGYQVSGECCKPIPGTRTCRDGTILSDWGGCCGKGACNIFCCNCDN 60 Query: 134 GCNSK 120 GC K Sbjct: 61 GCREK 65 >ref|XP_016266040.1| hypothetical protein PV06_01535 [Exophiala oligosperma] gb|KIW45824.1| hypothetical protein PV06_01535 [Exophiala oligosperma] Length = 167 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/57 (45%), Positives = 33/57 (57%), Gaps = 14/57 (24%) Frame = -2 Query: 257 LLFLIISSIAIKVNSECC-RRKPD-------------FGCCGNGRCNIFCCNCDGGC 129 +L +++S+ + V SECC + KPD GCC G CNIFCCNCDGGC Sbjct: 5 ILAFVLTSVGL-VASECCDQEKPDNVGQCLDGTYADYLGCCAYGPCNIFCCNCDGGC 60